MFI8

CAS No. 694488-83-0

MFI8( —— )

Catalog No. M35428 CAS No. 694488-83-0

MFI8 is a compound that regulates mitochondrial fission and can be used to study aging.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 126 Get Quote
5MG 188 Get Quote
10MG 312 Get Quote
25MG 596 Get Quote
50MG 1021 Get Quote
100MG 1449 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    MFI8
  • Note
    Research use only, not for human use.
  • Brief Description
    MFI8 is a compound that regulates mitochondrial fission and can be used to study aging.
  • Description
    MFI8 is a small molecule inhibitor of mitochondrial.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Mitochondrial Metabolism
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    694488-83-0
  • Formula Weight
    275.77
  • Molecular Formula
    C16H18ClNO
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (362.62 mM; Ultrasonic )
  • SMILES
    CC(Nc1cccc(C)c1C)c1cc(Cl)ccc1O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Zacharioudakis E, et al. Modulating mitofusins to control mitochondrial function and signaling. Nat Commun. 2022 Jul 7;13(1):3775.?
molnova catalog
related products
  • LSKL(a)

    LSKL Inhibitor of Thrombospondin (TSP-1) is a peptide derived from the latency-associated peptide inhibits thrombospondin (TSP-1) activation of TGF-β.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Peldesine

    Peldesine is an effective, competitive, reversible, and orally active inhibitor of purine nucleoside phosphorylase.