Home - Products - Others - Other Targets - Exendin-4 peptide derivative acetate

Exendin-4 peptide derivative acetate

CAS No. ——

Exendin-4 peptide derivative acetate( GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS )

Catalog No. M29853 CAS No. ——

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Exendin-4 peptide derivative acetate
  • Note
    Research use only, not for human use.
  • Brief Description
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • Description
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.(In Vitro):Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    ——
  • Formula Weight
    ——
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

US20150315260 A1
molnova catalog
related products
  • Lycopsamine

    Lycopsamine is a bioactive chemical.

  • Quercetin 3-O-sambub...

    Quercetin-3-O-sambubioside is a monomeric compound found in Eucommia ulmoides male flowers. Quercetin-3-O-sambubioside promotes the stimulation of the nerve center. Antioxidant and anticancer activities.

  • Sergliflozin etabona...

    Sergliflozin etabonate, a SGLT-2 inhibitor, is used potentially for the treatment of type 2 diabetes and obesity.