Home - Products - Others - Other Targets - 6,7-Dihydroxy-2,4-dimethoxyphenanthrene

6,7-Dihydroxy-2,4-dimethoxyphenanthrene

CAS No. 42050-16-8

6,7-Dihydroxy-2,4-dimethoxyphenanthrene( ——— )

Catalog No. M38366 CAS No. 42050-16-8

5,7-Dimethoxy-2,3-phenanthrenediol is a compound with estrogenic activity. 5,7-Dimethoxy-2,3-phenanthrenediol increases the proliferation of MCF-7 cell and the expression of ERβ in the MCF-7 cell line.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    6,7-Dihydroxy-2,4-dimethoxyphenanthrene
  • Note
    Research use only, not for human use.
  • Brief Description
    5,7-Dimethoxy-2,3-phenanthrenediol is a compound with estrogenic activity. 5,7-Dimethoxy-2,3-phenanthrenediol increases the proliferation of MCF-7 cell and the expression of ERβ in the MCF-7 cell line.
  • Description
    5,7-Dimethoxy-2,3-phenanthrenediol is a compound with estrogenic activity. 5,7-Dimethoxy-2,3-phenanthrenediol increases the proliferation of MCF-7 cell and the expression of ERβ in the MCF-7 cell line.
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    42050-16-8
  • Formula Weight
    270.28
  • Molecular Formula
    C16H14O4
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Zhang, Yan-Li; Zhao, Xuan; Zheng, Xiao-ke; Feng, Wei-Sheng (2019).?A new diphenylethane and a new dibenzb,foxepin with estrogenic activity from the stems and leaves of Dioscorea oppositifolia L. Phytochemistry Letters, 33(), 26–30.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Humic acid sodium sa...

    Sodium salt of humic acid and sodium silicate have similar enhancement on kerosene contaminated soil washing with saponin.

  • Pannexin - 1 Fragmen...

    Pannexin - 1 Fragment (4515)