Home - Products - Others - Other Targets - Tectorigenin-7-O-beta-glucosyl-4-O-beta-glucoside

Tectorigenin-7-O-beta-glucosyl-4-O-beta-glucoside

CAS No. 848128-32-5

Tectorigenin-7-O-beta-glucosyl-4-O-beta-glucoside( —— )

Catalog No. M32556 CAS No. 848128-32-5

The roots of Pueraria lobata.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
10MG 551 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Tectorigenin-7-O-beta-glucosyl-4-O-beta-glucoside
  • Note
    Research use only, not for human use.
  • Brief Description
    The roots of Pueraria lobata.
  • Description
    The roots of Pueraria lobata.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    848128-32-5
  • Formula Weight
    624.6
  • Molecular Formula
    C28H32O16
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • MKI-1

    MKI-1 (MASTL Kinase Inhibitor-1) is an inhibitor of MASTL (microtubule-associated serine/threonine kinase-like, IC50= 9.9 μM).

  • Piperanine

    Piperanine is a useful organic compound for research related to life sciences.