Mizoribine
CAS No. 50924-49-7
Mizoribine( NSC-289637 | HE-69 )
Catalog No. M14751 CAS No. 50924-49-7
An immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid ArthritisApproved
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 1 mL x 10 mM in DMSO | 29 | In Stock |
|
| 10MG | 42 | In Stock |
|
| 25MG | 58 | In Stock |
|
| 50MG | 83 | In Stock |
|
| 100MG | 114 | In Stock |
|
| 200MG | Get Quote | In Stock |
|
| 500MG | 276 | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameMizoribine
-
NoteResearch use only, not for human use.
-
Brief DescriptionAn immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid ArthritisApproved
-
DescriptionAn immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid Arthritis Approved(In Vitro):Mizoribine, isolated from culture medium of the mold Eupenicillium brefeldianum M-2166, acts as an immunosuppressant which exerts its effects without severe side effects.Mizoribine is an inosine-5′-monophosphate dehydrogenase (IMPDH) inhibitorused for renal transplantation, autoimmune diseases and steroid-resistant nephrotic syndrome .(In Vivo):Mizoribine suppresses collagen-induced arthritis. Mizoribine (10, 20 and 50 mg/kg; Administered orally 5 days a week for 12 weeks) reduces the arthritis score in a dose-dependent fashion, showing significant suppression, even at a dose of 10 mg/kg.
-
In VitroMizoribine, isolated from culture medium of the mold Eupenicillium brefeldianum M-2166, acts as an immunosuppressant which exerts its effects without severe side effects.Mizoribine is an inosine-5′-monophosphate dehydrogenase (IMPDH) inhibitorused for renal transplantation, autoimmune diseases and steroid-resistant nephrotic syndrome .
-
In VivoMizoribine suppresses collagen-induced arthritis. Mizoribine (10, 20 and 50 mg/kg; Administered orally 5 days a week for 12 weeks) reduces the arthritis score in a dose-dependent fashion, showing significant suppression, even at a dose of 10 mg/kg. Animal Model:Male DBA/1 J mice with collagen-induced arthritisDosage:10, 20 and 50 mg/kg Administration:Administered orally 5 days a week for 12 weeks Result:Showed dose-dependency of the suppressive effect.
-
SynonymsNSC-289637 | HE-69
-
PathwayOthers
-
TargetOther Targets
-
Recptormonophosphatesynthetase
-
Research AreaInflammation/Immunology
-
IndicationRheumatoid Arthritis
Chemical Information
-
CAS Number50924-49-7
-
Formula Weight259.216
-
Molecular FormulaC9H13N3O6
-
Purity>98% (HPLC)
-
SolubilityDMSO: ≥ 35 mg/mL
-
SMILESO=C(C1=C(O)N([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)C=N1)N
-
Chemical Name1H-Imidazole-4-carboxamide, 5-hydroxy-1-β-D-ribofuranosyl-
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
molnova catalog
related products
-
Exendin-4 peptide de...
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
-
8-Bromoguanosine
8-Bromoguanosine is a brominated derivative of guanosine. It is activate lymphocytes through an intracellular mechanism to exert immunostimulatory effects.
-
Xenopsin 2TFA(51827-...
Xenopsin(2TFA) is a neurotensin-like octapeptide?previously isolated from amphibian skin.The octapeptide xenopsin, previously isolated from amphibian skin, stimulates exocrine pancreatic secretion of bicarbonate and protein in conscious dogs and increases the volume of secretion.
Cart
sales@molnova.com