Mizoribine

CAS No. 50924-49-7

Mizoribine( NSC-289637 | HE-69 )

Catalog No. M14751 CAS No. 50924-49-7

An immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid ArthritisApproved

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 29 In Stock
10MG 42 In Stock
25MG 58 In Stock
50MG 83 In Stock
100MG 114 In Stock
200MG Get Quote In Stock
500MG 276 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Mizoribine
  • Note
    Research use only, not for human use.
  • Brief Description
    An immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid ArthritisApproved
  • Description
    An immunosuppressive agent that inhibits the proliferation of lymphocytes selectively, via inhibition of IMPDH.Rheumatoid Arthritis Approved(In Vitro):Mizoribine, isolated from culture medium of the mold Eupenicillium brefeldianum M-2166, acts as an immunosuppressant which exerts its effects without severe side effects.Mizoribine is an inosine-5′-monophosphate dehydrogenase (IMPDH) inhibitorused for renal transplantation, autoimmune diseases and steroid-resistant nephrotic syndrome .(In Vivo):Mizoribine suppresses collagen-induced arthritis. Mizoribine (10, 20 and 50 mg/kg; Administered orally 5 days a week for 12 weeks) reduces the arthritis score in a dose-dependent fashion, showing significant suppression, even at a dose of 10 mg/kg.
  • In Vitro
    Mizoribine, isolated from culture medium of the mold Eupenicillium brefeldianum M-2166, acts as an immunosuppressant which exerts its effects without severe side effects.Mizoribine is an inosine-5′-monophosphate dehydrogenase (IMPDH) inhibitorused for renal transplantation, autoimmune diseases and steroid-resistant nephrotic syndrome .
  • In Vivo
    Mizoribine suppresses collagen-induced arthritis. Mizoribine (10, 20 and 50 mg/kg; Administered orally 5 days a week for 12 weeks) reduces the arthritis score in a dose-dependent fashion, showing significant suppression, even at a dose of 10 mg/kg. Animal Model:Male DBA/1 J mice with collagen-induced arthritisDosage:10, 20 and 50 mg/kg Administration:Administered orally 5 days a week for 12 weeks Result:Showed dose-dependency of the suppressive effect.
  • Synonyms
    NSC-289637 | HE-69
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    monophosphatesynthetase
  • Research Area
    Inflammation/Immunology
  • Indication
    Rheumatoid Arthritis

Chemical Information

  • CAS Number
    50924-49-7
  • Formula Weight
    259.216
  • Molecular Formula
    C9H13N3O6
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO: ≥ 35 mg/mL
  • SMILES
    O=C(C1=C(O)N([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)C=N1)N
  • Chemical Name
    1H-Imidazole-4-carboxamide, 5-hydroxy-1-β-D-ribofuranosyl-

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • 8-Bromoguanosine

    8-Bromoguanosine is a brominated derivative of guanosine. It is activate lymphocytes through an intracellular mechanism to exert immunostimulatory effects.

  • Xenopsin 2TFA(51827-...

    Xenopsin(2TFA) is a neurotensin-like octapeptide?previously isolated from amphibian skin.The octapeptide xenopsin, previously isolated from amphibian skin, stimulates exocrine pancreatic secretion of bicarbonate and protein in conscious dogs and increases the volume of secretion.