alpha-Naphthoflavone

CAS No. 604-59-1

alpha-Naphthoflavone( —— )

Catalog No. M18879 CAS No. 604-59-1

Alpha-Naphthoflavone, a synthetic flavonoid, is a potent inhibitor of aromatase with an I50 value of 0.5 μM.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 35 In Stock
10MG 51 In Stock
25MG 85 In Stock
50MG 124 In Stock
100MG 188 In Stock
500MG 534 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    alpha-Naphthoflavone
  • Note
    Research use only, not for human use.
  • Brief Description
    Alpha-Naphthoflavone, a synthetic flavonoid, is a potent inhibitor of aromatase with an I50 value of 0.5 μM.
  • Description
    Alpha-Naphthoflavone, a synthetic flavonoid, is a potent inhibitor of aromatase with an I50 value of 0.5 μM.
  • In Vitro
    Cell Proliferation Assay Cell Line:HeLa Concentration:0.01, 1, 10, 100 μM Incubation Time:6 days Result:Decreased cell proliferation in a dose-dependent manner with IC50 value of 36.81 μM.Apoptosis Analysis Cell Line:HeLa Concentration:50 μM Incubation Time:12, 24, 36 h Result:Induced a mild but significant apoptosis rate.Western Blot Analysis Cell Line:HeLa Concentration:50 μM Incubation Time:12, 24, 36 h Result:Increased the level of p53 at 12 h.
  • In Vivo
    Animal Model:HFD-induced mice model Dosage:80, 160 mg/kg Administration:i.g.Result:Decreased the levels of AST, TG and TC.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Aromatase
  • Research Area
    Others-Field
  • Indication
    ——

Chemical Information

  • CAS Number
    604-59-1
  • Formula Weight
    272.3
  • Molecular Formula
    C19H12O2
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 25 mg/mL (91.81 mM)
  • SMILES
    C1=CC=C(C=C1)C2=CC(=O)C3=C(O2)C4=CC=CC=C4C=C3
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Anthracene-9-carboxy...

    Anthracene-9-carboxylic acid is an inhibitor of chloride transport with a moderate to strong inhibitory action on PKA activated cardiac IcI.

  • Thiamethoxam

    Thiamethoxam is an insecticide of broad-spectrum neonicotinoids.