RRX-001
CAS No. 925206-65-1
RRX-001( RRX001 | RRX 001 )
Catalog No. M16629 CAS No. 925206-65-1
RRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 2MG | 63 | In Stock |
|
| 5MG | 105 | In Stock |
|
| 10MG | 140 | In Stock |
|
| 25MG | 264 | In Stock |
|
| 50MG | 462 | In Stock |
|
| 100MG | 673 | In Stock |
|
| 500MG | 1404 | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameRRX-001
-
NoteResearch use only, not for human use.
-
Brief DescriptionRRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity.
-
DescriptionRRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity; targets CD133 + /CD44 + cancer stem cells from colon cancer cell-lines, HT-29, Caco-2, and HCT116, and inhibits Wnt pathway signalling with downregulation of c-Myc; inhibits HCT 116 and decreases levels of the DNA methyltransferases DNMT1 and DNMT3a in a time and dose-dependent manner; RRX-001 (RRX001) is a chemosensitizer in multiple tumor types and disease states including malaria, hemorrhagic shock and sickle cell anemia.Lung Cancer Phase 2 Clinical.
-
In VitroCell Viability Assay Cell Line:Human MM-cell lines (MM.1S, RPMI-8226, H929, ARP1, KMS-11, OPM2, LR5, ANBL6.WT), along with drug resistant cell lines such as (MM.1R, Dox40, LR5, ANBL6.BR, RPMI-8226).Concentration:0-5 μM.Incubation Time:24 hours.Result:Induced a dose-dependent significant (p < 0.05) decrease in viability of all cell lines.
-
In VivoAnimal Model:CB-17 SCID-mice were subcutaneously inoculated with 5.0 × 106 MM.1S cells in 100 μL of serum-free RPMI 1640 medium.Dosage:5 mg/kg or 10 mg/kg.Administration:I.V., thrice-weekly for 24 days.Result:Blocked MM tumor growth and enhances survival. Treatment was well tolerated, suggested by no apparent weight loss.Animal Model:Female BALB/c nude mice (19.2?±?1.7?g) based on A549 lung cancer model. Dosage: 10?mg/kg. Administration:IP, twice a week and once a day.Result:Resulted in the most significant tumor growth retardation.Reduction of resident macrophages in tumor-bearing mice attenuates the antitumor activity of RRx-001.
-
SynonymsRRX001 | RRX 001
-
PathwayOthers
-
TargetOther Targets
-
RecptorOther Targets
-
Research AreaCancer
-
IndicationLung Cancer
Chemical Information
-
CAS Number925206-65-1
-
Formula Weight268.023
-
Molecular FormulaC5H6BrN3O5
-
Purity>98% (HPLC)
-
SolubilityDMSO : ≥ 100 mg/mL 373.11 mM
-
SMILESO=[N+](C1([N+]([O-])=O)CN(C(CBr)=O)C1)[O-]
-
Chemical Name2-bromo-1-(3,3-dinitroazetidin-1-yl)ethan-1-one
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1. Reid T, et al. Lancet Oncol. 2015 Sep;16(9):1133-1142. doi: 10.1016/S1470-2045(15)00089-3.
2. Scicinski J, et al. Redox Biol. 2015 Aug;5:422. doi: 10.1016/j.redox.2015.09.035.
3. Kim MM, et al. Transl Oncol. 2016 Apr;9(2):108-113.
4. Oronsky B, et al. Invest New Drugs. 2016 Jun;34(3):371-7.
molnova catalog
related products
-
6-chloro-1-ethyl-7-(...
6-chloro-1-ethyl-7-(4-methylpiperazin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acid is a compound used as a molecular building block.
-
Coelenteramine 400a
Coelenteramine 400a (Coelenterazine 400a), a Coelenterazine derivative, serves as a substrate for Renilla luciferase (RLuc), facilitating the emission of blue light at 395 nm.
-
Exendin-4 peptide de...
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Cart
sales@molnova.com