RRX-001

CAS No. 925206-65-1

RRX-001( RRX001 | RRX 001 )

Catalog No. M16629 CAS No. 925206-65-1

RRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 63 In Stock
5MG 105 In Stock
10MG 140 In Stock
25MG 264 In Stock
50MG 462 In Stock
100MG 673 In Stock
500MG 1404 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    RRX-001
  • Note
    Research use only, not for human use.
  • Brief Description
    RRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity.
  • Description
    RRX-001 (RRX001) is a novel NO and hypoxia mediated anticancer agent with with epigenetic and immunologic activity; targets CD133 + /CD44 + cancer stem cells from colon cancer cell-lines, HT-29, Caco-2, and HCT116, and inhibits Wnt pathway signalling with downregulation of c-Myc; inhibits HCT 116 and decreases levels of the DNA methyltransferases DNMT1 and DNMT3a in a time and dose-dependent manner; RRX-001 (RRX001) is a chemosensitizer in multiple tumor types and disease states including malaria, hemorrhagic shock and sickle cell anemia.Lung Cancer Phase 2 Clinical.
  • In Vitro
    Cell Viability Assay Cell Line:Human MM-cell lines (MM.1S, RPMI-8226, H929, ARP1, KMS-11, OPM2, LR5, ANBL6.WT), along with drug resistant cell lines such as (MM.1R, Dox40, LR5, ANBL6.BR, RPMI-8226).Concentration:0-5 μM.Incubation Time:24 hours.Result:Induced a dose-dependent significant (p < 0.05) decrease in viability of all cell lines.
  • In Vivo
    Animal Model:CB-17 SCID-mice were subcutaneously inoculated with 5.0 × 106 MM.1S cells in 100 μL of serum-free RPMI 1640 medium.Dosage:5 mg/kg or 10 mg/kg.Administration:I.V., thrice-weekly for 24 days.Result:Blocked MM tumor growth and enhances survival. Treatment was well tolerated, suggested by no apparent weight loss.Animal Model:Female BALB/c nude mice (19.2?±?1.7?g) based on A549 lung cancer model. Dosage: 10?mg/kg. Administration:IP, twice a week and once a day.Result:Resulted in the most significant tumor growth retardation.Reduction of resident macrophages in tumor-bearing mice attenuates the antitumor activity of RRx-001.
  • Synonyms
    RRX001 | RRX 001
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Other Targets
  • Research Area
    Cancer
  • Indication
    Lung Cancer

Chemical Information

  • CAS Number
    925206-65-1
  • Formula Weight
    268.023
  • Molecular Formula
    C5H6BrN3O5
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO : ≥ 100 mg/mL 373.11 mM
  • SMILES
    O=[N+](C1([N+]([O-])=O)CN(C(CBr)=O)C1)[O-]
  • Chemical Name
    2-bromo-1-(3,3-dinitroazetidin-1-yl)ethan-1-one

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Reid T, et al. Lancet Oncol. 2015 Sep;16(9):1133-1142. doi: 10.1016/S1470-2045(15)00089-3. 2. Scicinski J, et al. Redox Biol. 2015 Aug;5:422. doi: 10.1016/j.redox.2015.09.035. 3. Kim MM, et al. Transl Oncol. 2016 Apr;9(2):108-113. 4. Oronsky B, et al. Invest New Drugs. 2016 Jun;34(3):371-7.
molnova catalog
related products
  • 6-chloro-1-ethyl-7-(...

    6-chloro-1-ethyl-7-(4-methylpiperazin-1-yl)-4-oxo-1,4-dihydroquinoline-3-carboxylic acid is a compound used as a molecular building block.

  • Coelenteramine 400a

    Coelenteramine 400a (Coelenterazine 400a), a Coelenterazine derivative, serves as a substrate for Renilla luciferase (RLuc), facilitating the emission of blue light at 395 nm.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.