Cart
sales@molnova.com
Home - Products - Others - Other Targets - Pyrithione

Pyrithione

CAS No. 1121-30-8

Pyrithione ( 1-hydroxyl-1H-pyridine-2-thione )

Catalog No. M26402 CAS No. 1121-30-8

Pyrithione is a transition metal complex, a zinc ionophore, that causes elevated zinc levels in mammalian cells. Pyrithione has potent bactericidal and antifungal activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 37 Get Quote
10MG 51 Get Quote
25MG 78 Get Quote
50MG 104 Get Quote
100MG 141 Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote
Group Booking Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Pyrithione
  • Note
    Research use only, not for human use.
  • Brief Description
    Pyrithione is a transition metal complex, a zinc ionophore, that causes elevated zinc levels in mammalian cells. Pyrithione has potent bactericidal and antifungal activity.
  • Description
    Pyrithione is a transition metal complex, a zinc ionophore, that causes elevated zinc levels in mammalian cells. Pyrithione has potent bactericidal and antifungal activity.
  • Synonyms
    1-hydroxyl-1H-pyridine-2-thione
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1121-30-8
  • Formula Weight
    127.2
  • Molecular Formula
    C5H5NOS
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    On1ccccc1=S
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Suzanne AKERS-RODRIGUEZLeslie W. Tari. Compositions and methods for the treatment of human immunodeficiency virus.WO2021081515A2
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Tyroserleutide

    Tyroserleutide (YSL), isolated from the degradation products of porcine spleen, is a small molecular tripeptide which inhibits tumor growth both in vitro and in vivo.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • debutylbupivacaine

    It is the intermediate of Ropivacaine Hydrochloride and Bupivacain.

Sign In Join Free