Home - Products - Others - Other Targets - Biotin-Atrial Natriuretic Peptide (1-28), human, porcine

Biotin-Atrial Natriuretic Peptide (1-28), human, porcine

CAS No. ———

Biotin-Atrial Natriuretic Peptide (1-28), human, porcine( ——— )

Catalog No. M41420 CAS No. ———

Biotin-Atrial Natriuretic Peptide (1-28), human, porcine

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Biotin-Atrial Natriuretic Peptide (1-28), human, porcine
  • Note
    Research use only, not for human use.
  • Brief Description
    Biotin-Atrial Natriuretic Peptide (1-28), human, porcine
  • Description
    Biotin-Atrial Natriuretic Peptide (1-28), human, porcine
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    3308.8
  • Molecular Formula
    C137H217N47O41S4
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Thiamphenicol

    Thiamphenicol is an antimicrobial antibiotic and a methyl-sulfonyl analogue of chloramphenicol.

  • α-Casein 90-95

    α-Casein (90-95) is a peptide fragment of α-Casein.