Home - Products - Others - Other Targets - Neuropeptide Y (2-36) (porcine)

Neuropeptide Y (2-36) (porcine)

CAS No. 102961-52-4

Neuropeptide Y (2-36) (porcine)( ——— )

Catalog No. M40286 CAS No. 102961-52-4

Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Neuropeptide Y (2-36) (porcine)
  • Note
    Research use only, not for human use.
  • Brief Description
    Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.
  • Description
    Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.
  • In Vitro
    The following information is for reference:Neuropeptide Y (2-36) (porcine): PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2;Neuropeptide Y (2-36) (human, rat): PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (97.14% homology to porcine).
  • In Vivo
    Neuropeptide Y (2-36) (porcine) (1.23 μg/rat; i.c.v.; single) induces food intake in rats.Animal Model:Male Sprague-Dawley rats (180-220 g).Dosage:1.23 μg/rat (300 pmol/rat) Administration:Intracerebroventricular injection; single Result:Increased food intake to 5.0 g 4 hours later.
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    102961-52-4
  • Formula Weight
    4090.6
  • Molecular Formula
    C181H278N54O55
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Gerald C, et al. A receptor subtype involved in neuropeptide-Y-induced food intake. Nature. 1996 Jul 11;382(6587):168-71. ?
molnova catalog
related products
  • Decimemide

    Decimemide (V-285) is an alkoxybenzoic acid derivative with antiepileptic activity and potential anticonvulsant activity that can be used to study neurological disorders.

  • Bovine albumin

    Bovine albumin is a?globular protein that is used in numerous biochemical applications.

  • Dehydroacetic acid

    Dehydroacetic acid is an organic compound, classified as a pyrone derivative and is used mostly as a fungicide and bactericide.