Cart
sales@molnova.com
Neuropeptide Y (2-36) (porcine)
CAS No. 102961-52-4
Neuropeptide Y (2-36) (porcine)( ——— )
Catalog No. M40286 CAS No. 102961-52-4
Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 25MG | Get Quote | Get Quote |
|
| 50MG | Get Quote | Get Quote |
|
| 100MG | Get Quote | Get Quote |
|
| 200MG | Get Quote | Get Quote |
|
| 500MG | Get Quote | Get Quote |
|
| 1G | Get Quote | Get Quote |
|
Biological Information
-
Product NameNeuropeptide Y (2-36) (porcine)
-
NoteResearch use only, not for human use.
-
Brief DescriptionNeuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.
-
DescriptionNeuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.
-
In VitroThe following information is for reference:Neuropeptide Y (2-36) (porcine): PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2；Neuropeptide Y (2-36) (human, rat): PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (97.14% homology to porcine).
-
In VivoNeuropeptide Y (2-36) (porcine) (1.23 μg/rat; i.c.v.; single) induces food intake in rats.Animal Model:Male Sprague-Dawley rats (180-220 g).Dosage:1.23 μg/rat (300 pmol/rat) Administration:Intracerebroventricular injection; single Result:Increased food intake to 5.0 g 4 hours later.
-
Synonyms———
-
PathwayOthers
-
TargetOther Targets
-
Recptor———
-
Research Area———
-
Indication———
Chemical Information
-
CAS Number102961-52-4
-
Formula Weight4090.6
-
Molecular FormulaC181H278N54O55
-
Purity>98% (HPLC)
-
Solubility———
-
SMILES———
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1. Gerald C, et al. A receptor subtype involved in neuropeptide-Y-induced food intake. Nature. 1996 Jul 11;382(6587):168-71. ?
molnova catalog
related products
-
trans-2-Decenoic aci...
Trans-2-Decenoic acid is an unsaturated fatty acid found in royal jelly produced from the hypopharyngeal and mandibular gland secretions of honeybees.
-
Tefludazine
Tefludazine, a novel neuroleptic with a benzindone structure, is a compound with good oral activity and antagonistic effects on dopamine and 5-hydroxytryptamine receptors.
-
(S)-armepavine
(+)-Armepavine is a bioactive compound with pharmacological activity. As an alkaloid, (+)-Armepavine belongs to the tetrahydrobenzylisoquinoline class of compounds and may play a role in inhibiting certain diseases. The chemical structure and properties of (+)-Armepavine make it an important chemical classification in phytochemistry.
