Thymosin β4 (16-38)

CAS No. ———

Thymosin β4 (16-38)( ——— )

Catalog No. M40103 CAS No. ———

Thymosin β4 (16-38)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Thymosin β4 (16-38)
  • Note
    Research use only, not for human use.
  • Brief Description
    Thymosin β4 (16-38)
  • Description
    Thymosin β4 (16-38)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    ———
  • Molecular Formula
    ———
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • CYM50260

    CYM50260 is an exquisitely agonist of sphingosine-1-phosphate 4 receptor (S1P4-R) (EC50: 45 nM).

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Imazalil

    Enilconazole (synonyms imazalil, chloramizole) is a fungicide widely used in agriculture, particularly in the growing of citrus fruits. Enilconazole is also used in veterinary medicine as a topical antimycotic.