Home - Products - Others - Other Targets - Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside

Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside

CAS No. ———

Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside( ——— )

Catalog No. M38744 CAS No. ———

Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside
  • Note
    Research use only, not for human use.
  • Brief Description
    Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside
  • Description
    Isorhamnetin 3-O-α-L-arabinoside-7- O-α-L-rhamnoside
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    ———
  • Molecular Formula
    ———
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • MitoBloCK-11?(MB-11)

    MitoBloCK-11 (MB-11) is a s mall molecule inhibitor of mitochondrial protein import possibly acts through transport protein Seo1, but not Tom70 or Tom20;?inhibits precursor proteins that contain hydrophobic segments, confers growth in media lacking uracil in a specific manner and affects zebrafish development.

  • Carasiphenol C

    Carasiphenol C is a natural product from Carex humilis Leyss.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.