(Rac)-EC5026
CAS No. 1809885-55-9
(Rac)-EC5026( —— )
Catalog No. M37677 CAS No. 1809885-55-9
(Rac)-EC5026 ((Rac)-BPN-19186) is a potent piperidine inhibitor of soluble epoxide hydrolase (sEH) with a Ki of 0.06 nM, useful for research on Parkinson's disease and dementia with Lewy Bodies (DLB) .
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 1 mL x 10 mM in DMSO | 93 | In Stock |
|
| 5MG | 85 | In Stock |
|
| 10MG | 136 | In Stock |
|
| 25MG | 226 | In Stock |
|
| 50MG | 316 | In Stock |
|
| 100MG | 429 | In Stock |
|
| 200MG | 592 | In Stock |
|
| 500MG | Get Quote | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product Name(Rac)-EC5026
-
NoteResearch use only, not for human use.
-
Brief Description(Rac)-EC5026 ((Rac)-BPN-19186) is a potent piperidine inhibitor of soluble epoxide hydrolase (sEH) with a Ki of 0.06 nM, useful for research on Parkinson's disease and dementia with Lewy Bodies (DLB) .
-
Description(Rac)-EC5026 ((Rac)-BPN-19186) is a potent piperidine inhibitor of soluble epoxide hydrolase (sEH) extracted from patent WO2019156991A1, page 39, has a Ki of 0.06 nM. (Rac)-EC5026 can be used for the research ofParkinson's disease and dementia with Lewy Bodies (DLB).
-
In Vitro(Rac)-EC5026 inhibits soluble epoxide hydrolase (sEH), with a Ki of 0.06 nM.
-
In Vivo——
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
RecptorEpoxide Hydrolase
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number1809885-55-9
-
Formula Weight405.39
-
Molecular FormulaC18H23F4N3O3
-
Purity>98% (HPLC)
-
SolubilityIn Vitro:?DMSO : 250 mg/mL (616.69 mM; Ultrasonic )
-
SMILESCCC(C)C(=O)N1CCC(CC1)NC(=O)Nc1ccc(OC(F)(F)F)c(F)c1
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1. Hammock BD, et, al. Methods of inhibiting formation of alpha synuclein aggregates. WO2019156991A1.
molnova catalog
related products
-
Baccatin III
Baccatin III is an isolate of the Pacific yew tree (Taxus brevifolia) and related species. Baccatin III is a precursor to the anti-Y drug paclitaxel (Taxol).
-
[Cys0]-GTP-Binding P...
[Cys0]-GTP-Binding Protein Gsa (28-42); GTP-Binding Protein Fragment, Gs alpha
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
Cart
sales@molnova.com