Disitamab

CAS No. 2185868-98-6

Disitamab( —— )

Catalog No. M36836 CAS No. 2185868-98-6

Disitamab Vedotin (RC48-0) is a humanized monoclonal antibody that targets HER2 and can be utilized in creating antibody-drug conjugates (ADCs), specifically referred to as Disitamab Vedotin .

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 715 In Stock
10MG 1121 In Stock
25MG 1691 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Disitamab
  • Note
    Research use only, not for human use.
  • Brief Description
    Disitamab Vedotin (RC48-0) is a humanized monoclonal antibody that targets HER2 and can be utilized in creating antibody-drug conjugates (ADCs), specifically referred to as Disitamab Vedotin .
  • Description
    Disitamab (RC48-0) is a humanized monoclonal antibody targeting HER2. Disitamab can be used in the synthesis of antibody-drug conjugates (ADCs), Disitamab vedotin (Disitamab vedotin (HY-P9985)).
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ADC Antibody
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    2185868-98-6
  • Formula Weight
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Jiang J, et al. Preclinical safety profile of disitamab vedotin:a novel anti-HER2 antibody conjugated with MMAE. Toxicol Lett. 2020;324:30-37. ?
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Palmitic acid

    Extracted from Palm tree fruit;Store the product in sealed, cool and dry condition.

  • [Sar1,Thr8]-Angioten...

    [Sar1,Thr8]-Angiotensin II is a potent angiotensin II antagonist. [Sar1,Thr8]-Angiotensin II does not alter cardiac performance. [Sar1,Thr8]-Angiotensin II might be safe for patients with cardiac disease.