Syringetin

CAS No. 4423-37-4

Syringetin( —— )

Catalog No. M32120 CAS No. 4423-37-4

Syringetin is a natural product for research related to life sciences.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 275 In Stock
10MG 471 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Syringetin
  • Note
    Research use only, not for human use.
  • Brief Description
    Syringetin is a natural product for research related to life sciences.
  • Description
    Syringetin is a natural product for research related to life sciences.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    4423-37-4
  • Formula Weight
    346.3
  • Molecular Formula
    C17H14O8
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Lumazine

    Lumazine is a new MALDI matrix for complex (phospho)lipid mixtures analysis.

  • Deapi-platycodin D

    Deapi-platycodin and platycodin D can regulate the production and secretion of airway mucin and.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.