11-Oxomogroside IV

CAS No. 2096516-32-2

11-Oxomogroside IV( —— )

Catalog No. M31923 CAS No. 2096516-32-2

11-Oxomogroside IV is a natural product.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 311 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    11-Oxomogroside IV
  • Note
    Research use only, not for human use.
  • Brief Description
    11-Oxomogroside IV is a natural product.
  • Description
    11-Oxomogroside IV is a natural product.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    2096516-32-2
  • Formula Weight
    1123.3
  • Molecular Formula
    C54H90O24
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • (Met(O)5)-Enkephalin

    (Met(O)5)-Enkephalin

  • [D-Cys6,Asn7,D-Ala11...

    [D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)