Onjisaponin Z

CAS No. 1078708-72-1

Onjisaponin Z( —— )

Catalog No. M31763 CAS No. 1078708-72-1

Onjisaponin Z is a natural product.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 743 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Onjisaponin Z
  • Note
    Research use only, not for human use.
  • Brief Description
    Onjisaponin Z is a natural product.
  • Description
    Onjisaponin Z is a natural product.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1078708-72-1
  • Formula Weight
    1471.59
  • Molecular Formula
    C71H106O32
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 25 mg/mL (16.99 mM)
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Valnemulin HCl

    Valnemulin HCl is a broad-spectrum bacteriostatic agent inhibiting protein synthesis in bacteria by binding to the peptidyl transferase component of the 50S subunit of ribosomes.

  • Thioacetazone

    Thioacetazone is a thiosemicarbazone that?thioacetazone treatment of pulmonary tuberculosis.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.