Home - Products - Others - Other Targets - 2,4-Dihydroxy-6-methoxyacetophenone

2,4-Dihydroxy-6-methoxyacetophenone

CAS No. 3602-54-8

2,4-Dihydroxy-6-methoxyacetophenone( —— )

Catalog No. M30946 CAS No. 3602-54-8

2,4-Dihydroxy-6-methoxyacetophenone exhibits a moderate antispasmodic activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 76 In Stock
5MG 57 In Stock
10MG 81 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    2,4-Dihydroxy-6-methoxyacetophenone
  • Note
    Research use only, not for human use.
  • Brief Description
    2,4-Dihydroxy-6-methoxyacetophenone exhibits a moderate antispasmodic activity.
  • Description
    2,4-Dihydroxy-6-methoxyacetophenone exhibits a moderate antispasmodic activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    3602-54-8
  • Formula Weight
    182.2
  • Molecular Formula
    C9H10O4
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • β-Amyloid (16-20)

    β-Amyloid (16-20)

  • Povidone-iodine

    Povidone-iodine is an iodinated polyvinyl polymer used as topical antiseptic in surgery and for skin and mucous membrane infections, also as aerosol.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.