Substance P, Free Acid

CAS No. 71977-09-8

Substance P, Free Acid( —— )

Catalog No. M30486 CAS No. 71977-09-8

Substance P, Free Acid is a native substance P analog, but shows no biological activity of substance P.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 81 Get Quote
10MG 138 Get Quote
25MG 279 Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Substance P, Free Acid
  • Note
    Research use only, not for human use.
  • Brief Description
    Substance P, Free Acid is a native substance P analog, but shows no biological activity of substance P.
  • Description
    Substance P, Free Acid is a native substance P analog, but shows no biological activity of substance P.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    71977-09-8
  • Formula Weight
    1348.61
  • Molecular Formula
    C63H97N17O14S
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    Sequence:Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Patel AB, et al. Substance P (free acid) adopts different conformation than native peptide in DMSO, water and DPPC bilayers. J Biomol Struct Dyn. 2001 Aug;19(1):129-38.
molnova catalog
related products
  • Toddaculin

    Toddaculine may be beneficial for the prevention and treatment of osteoporosis, it can not only inhibit the differentiation of osteoclasts via activation of the NF-κB, ERK 1/2, and p38 MAPK signaling pathways.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Adropin (34-76) (hum...

    Adropin (34-76) (human, mouse, rat) is a peptide that attenuates liver fibrosis and insulin resistance independent of obesity or food intake.