Orexin A (human, rat, mouse) (TFA)
CAS No. ——
Orexin A (human, rat, mouse) (TFA) ( —— )
Catalog No. M30249 CAS No. ——
Endogenous agonist at orexin receptors (Ki values are 20 and 38 nM for OX1 and OX2 receptors respectively). Stimulates feeding following central administration and may be involved in the control of sleep-wake cycle and other hypothalamic functions.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 100MG | Get Quote | Get Quote |
|
| 200MG | Get Quote | Get Quote |
|
| 500MG | Get Quote | Get Quote |
|
| 1G | Get Quote | Get Quote |
|
Biological Information
-
Product NameOrexin A (human, rat, mouse) (TFA)
-
NoteResearch use only, not for human use.
-
Brief DescriptionEndogenous agonist at orexin receptors (Ki values are 20 and 38 nM for OX1 and OX2 receptors respectively). Stimulates feeding following central administration and may be involved in the control of sleep-wake cycle and other hypothalamic functions.
-
DescriptionEndogenous agonist at orexin receptors (Ki values are 20 and 38 nM for OX1 and OX2 receptors respectively). Stimulates feeding following central administration and may be involved in the control of sleep-wake cycle and other hypothalamic functions. (In Vitro):Orexin A human, rat, mouse TFA has high affinity for OX1R, with 38 nM IC50 and 34 nM EC50 values in the the [Ca2﹢]i transient assay.(In Vivo):Orexin A human, rat, mouse TFA (3-30 mg/kg; i.v.; 5 min pre-test) significantly increases the latency to response at 10 and 30 mg/kg i.v. when given 5 min pre-test from 24.8±2.0 s in vehicle-treated mice to 35.0±3.7 s and 45.7±4.5 s, respectively. Orexin A human, rat, mouse TFA (3, 10 and 30 mg/kg; i.v.) is given immediately before phenylp-quinone (PPQ) and increases the latency to the first PPQ-induced constriction from 357.4±35.2 s in vehicle-treated mice to 500.3±31.2 s at 10 mg/kg and 594.5±5.5 s at 30 mg/kg.
-
In Vitro——
-
In Vivo——
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
Recptor——
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number——
-
Formula Weight3675.12
-
Molecular FormulaC154H244N47F3O46S4
-
Purity>98% (HPLC)
-
Solubility——
-
SMILES——
-
Chemical NameSequence:{Glp}-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-IIE-Leu-Thr-Leu-NH2 (Disulfide bridge: Cys6-Cys12, Cys7-Cys14)
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
Sakurai T, et al. Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior. Cell. 1998 Feb 20;92(4):573-85.
molnova catalog
related products
-
cis-3-Hexenyl hexano...
cis-3-Hexenyl hexanoate existing in some fruit has strong diffuse fruit aroma.
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
-
Memantine
Memantine, an amantadine derivative with some dopaminergic effects, has been proposed as an antiparkinson agent and has may be used to treat moderate to severe Alzheimer's disease. It acts on the glutamatergic system by blocking NMDA receptors.
Cart
sales@molnova.com