GB 1b

CAS No. 19360-72-6

GB 1b( —— )

Catalog No. M29302 CAS No. 19360-72-6

GB 1b is a natural product isolated from the leaves of Garcinia travancorica.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    GB 1b
  • Note
    Research use only, not for human use.
  • Brief Description
    GB 1b is a natural product isolated from the leaves of Garcinia travancorica.
  • Description
    GB 1b is a natural product isolated from the leaves of Garcinia travancorica.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    19360-72-6
  • Formula Weight
    542.49
  • Molecular Formula
    C30H22O10
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    Oc1ccc(cc1)[C@@H]1CC(=O)c2c(O)cc(O)c([C@@H]3[C@H](Oc4cc(O)cc(O)c4C3=O)c3ccc(O)cc3)c2O1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 24-Dihydroxypyrimidi...

    24-Dihydroxypyrimidine-5-carboxylic acid (Uracil-5-carboxylic acid) has been obtained from 5-formyluracil by the action of enzyme thymine 7-hydroxylase. It has been used to synthesize N1-alkylated uracil derivatives.

  • Benzotript

    Benzotript is an gastrin-receptor antagonist, with anti-gastrinic.proglumide and benzotript, a new tryptophan derivative, to inhibit acid output from isolated gastric fundic parietal cells from rabbit.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.