4-POBN

CAS No. 5351-17-7

4-POBN( Myeloperoxidase Inhibitor 1 | 4-ABAH | NSC-640 | 4-Aminobenzohydrazide | NSC640 | NSC 640 )

Catalog No. M27839 CAS No. 5351-17-7

4-POBN is a potent and irreversible inhibitor of myeloperoxidase (IC50 = 0.3 μM). 4-POBN can be used in studies about subacute stroke.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 28 In Stock
100MG Get Quote In Stock
200MG 32 In Stock
500MG 49 In Stock
1G 72 In Stock

Biological Information

  • Product Name
    4-POBN
  • Note
    Research use only, not for human use.
  • Brief Description
    4-POBN is a potent and irreversible inhibitor of myeloperoxidase (IC50 = 0.3 μM). 4-POBN can be used in studies about subacute stroke.
  • Description
    4-POBN is a potent and irreversible inhibitor of myeloperoxidase (IC50 = 0.3 μM). 4-POBN can be used in studies about subacute stroke.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Myeloperoxidase Inhibitor 1 | 4-ABAH | NSC-640 | 4-Aminobenzohydrazide | NSC640 | NSC 640
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Thyroid hormone
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    5351-17-7
  • Formula Weight
    151.169
  • Molecular Formula
    C7H9N3O
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : ≥ 25 mg/mL (165.38 mM)
  • SMILES
    NNC(=O)c1ccc(N)cc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Latika Singh, et al. Chasing the Elusive Benzofuran Impurity of the THR Antagonist NH-3: Synthesis, Isotope Labeling, and Biological Activity. J Org Chem. 2016 Mar 4;81(5):1870-6.
molnova catalog
related products
  • EGTA-AM

    EGTA-AM (EGTA Acetoxymethyl ester) is a calcium chelator, a metabolic biomarker of early-onset preeclampsia and late-onset preeclampsia.

  • Glucomoringin

    The seeds of Sinapis alba L.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.