Cbz-NH-PEG1-CH2COOH

CAS No. 1260092-43-0

Cbz-NH-PEG1-CH2COOH( —— )

Catalog No. M26934 CAS No. 1260092-43-0

Cbz-NH-PEG1-CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 29 In Stock
100MG 33 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Cbz-NH-PEG1-CH2COOH
  • Note
    Research use only, not for human use.
  • Brief Description
    Cbz-NH-PEG1-CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.
  • Description
    Cbz-NH-PEG1-CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.(In Vitro):PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vitro
    PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    anandamide cellular uptake| CB1| Human Endogenous Metabolite| TRPV1
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1260092-43-0
  • Formula Weight
    253.254
  • Molecular Formula
    C12H15NO5
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (394.87 mM)
  • SMILES
    OC(=O)COCCNC(=O)OCc1ccccc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Ortar G, et al. Novel selective and metabolically stable inhibitors of anandamide cellular uptake. Biochem Pharmacol. 2003 May 1;65(9):1473-81.
molnova catalog
related products
  • 2,4-Dihydroxy-6-meth...

    2,4-Dihydroxy-6-methoxyacetophenone exhibits a moderate antispasmodic activity.

  • 1,2-Dioleoyl-sn-glyc...

    1,2-Dioleoyl-sn-glycero-3-phospho-L-serine sodium can be used in lipid mixtures with DOPC and DOPE as effective nontoxic and nonviral DNA vectors.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.