Biotin-C5-amino-C5-amino

CAS No. 89889-51-0

Biotin-C5-amino-C5-amino( —— )

Catalog No. M26900 CAS No. 89889-51-0

Biotin-C5-amino-C5-amino is an alkyl chain-based PROTAC linker that can be used in the synthesis of PROTACs.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG 28 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Biotin-C5-amino-C5-amino
  • Note
    Research use only, not for human use.
  • Brief Description
    Biotin-C5-amino-C5-amino is an alkyl chain-based PROTAC linker that can be used in the synthesis of PROTACs.
  • Description
    Biotin-C5-amino-C5-amino is an alkyl chain-based PROTAC linker that can be used in the synthesis of PROTACs.(In Vitro):PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vitro
    PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Angiotensin-converting Enzyme (ACE)
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    89889-51-0
  • Formula Weight
    470.63
  • Molecular Formula
    C22H38N4O5S
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    [H][C@]12CS[C@@H](CCCCC(=O)NCCCCCC(=O)NCCCCCC(O)=O)[C@@]1([H])NC(=O)N2
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Peters DC, et al. Trandolapril. An update of its pharmacology and therapeutic use in cardiovascular disorders. Drugs. 1998 Nov;56(5):871-93.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Matairesinol

    Matairesinol has radical and superoxide scavenging activities; it also has anti-angiogenic activity by suppressing mROS signaling , can decrease hypoxia-inducible factor-1α± in hypoxic HeLa cells.

  • Methyl pseudolarate ...

    Methyl pseudolarate A is a diterpenoid compound that exerts its antitumor activity by inhibiting cell proliferation and inducing apoptosis.