naphthalene-1,3,6,8-tetrol

CAS No. 18512-30-6

naphthalene-1,3,6,8-tetrol( 1,3,6,8-THN | T4HN )

Catalog No. M23842 CAS No. 18512-30-6

The pentaketide 1,3,6,8-tetrahydroxynaphthalene (T4HN) is a key precursor of 1,8-dihydroxynaphthalene-melanin.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 85 In Stock
2MG 46 In Stock
5MG 76 In Stock
10MG 116 In Stock
25MG 235 In Stock
50MG 346 In Stock
100MG 500 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    naphthalene-1,3,6,8-tetrol
  • Note
    Research use only, not for human use.
  • Brief Description
    The pentaketide 1,3,6,8-tetrahydroxynaphthalene (T4HN) is a key precursor of 1,8-dihydroxynaphthalene-melanin.
  • Description
    The pentaketide 1,3,6,8-tetrahydroxynaphthalene (T4HN) is a key precursor of 1,8-dihydroxynaphthalene-melanin, an important virulence factor in pathogenic fungi, where T4HN is believed to be the direct product of pentaketide synthases
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    1,3,6,8-THN | T4HN
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    18512-30-6
  • Formula Weight
    192.17
  • Molecular Formula
    C10H8O4
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:120mg/ml(624.45mM; need ultrasonic)
  • SMILES
    Oc1cc(O)c2c(O)cc(O)cc2c1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Isohomoarbutin

    Isohomoarbutin is a natural product from the whole herb of Pyrola rotundifolia (Pyrolaceae).

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Isoorientin-2-O-(6-(...

    Isoorientin-2''-O-(6'''-(E)-p-coumaroyl)-glucoside