Bromosporine

CAS No. 1619994-69-2

Bromosporine( Bromosporine )

Catalog No. M18093 CAS No. 1619994-69-2

Bromosporine is a broad spectrum inhibitor for bromodomains for BRD2/4/9 and CECR2 (IC50: 0.41/0.29/0.122/0.017 μM), respectively.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 93 In Stock
2MG 52 In Stock
5MG 85 In Stock
10MG 136 In Stock
25MG 275 In Stock
50MG 431 In Stock
100MG 687 In Stock
200MG 918 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Bromosporine
  • Note
    Research use only, not for human use.
  • Brief Description
    Bromosporine is a broad spectrum inhibitor for bromodomains for BRD2/4/9 and CECR2 (IC50: 0.41/0.29/0.122/0.017 μM), respectively.
  • Description
    Bromosporine is a broad spectrum inhibitor for bromodomains and as such will be very useful in elucidating further biological roles of reader domains as well as a tool for the validation of functional assays. Proteins that contain BRDs have been implicated in the development of a large variety of diseases, including various cancers, inflammatory diseases and neurological diseases and the therapeutic potential of bromodomain inhibition has been shown in several of these diseases, such as HIV, cancer and inflammation.
  • In Vitro
    Cell Proliferation Assay Cell Line:HCT116 and HT29 Concentration:0, 30, 60, 120, 240, 480 and 1000 nM Incubation Time:72 h Result:Synergistically inhibited cell growth in CRC cells with 5-FU (HY-90006) (0-16 μg/mL) and exhibited a dose-dependent manner.Cell Cycle Analysis Cell Line:HCT116 and HT29 Concentration:Various concentration Incubation Time:48 h Result:Caused a distinct increase in the cells arrested at G1 phase when combined with 5-FU (HY-90006). Western Blot Analysis Cell Line:HCT116 and HT29 Concentration:Various concentration Incubation Time:48 h Result:Elevated the level of apoptosis in both cell lines through cleavage of PARP, caspase 3, and 9.Cell Proliferation Assay Cell Line:MV4;11, KASUMI-1, OCI-AML3 and K562 Concentration:0.1, 0.5 and 1 μM Incubation Time:6-10 days Result:Inhibited these AML cells in a dose-dependent manner.Cell Cytotoxicity Assay Cell Line:PBMCs Concentration:1 μM, 2.5 μM, 5 μM, 10 μM, 25 μM and 50 μM Incubation Time:48 hResult:Did not induce marked toxicity in primary CD4+ T cells with CC50 over 10 μM.
  • In Vivo
    Animal Model:Female BALB/c nude mice (5-6 weeks; injected with 1?×?106?cells/100?μL of HT116?cells) Dosage:100 mg/kg Administration:i.p.; daily for 10 days Result:Exhibited better antitumor activity than individual Bromosporine or 5-FU (HY-90006) when co-treated with the two agent.
  • Synonyms
    Bromosporine
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    BRD
  • Research Area
    Others-Field
  • Indication
    ——

Chemical Information

  • CAS Number
    1619994-69-2
  • Formula Weight
    404.45
  • Molecular Formula
    C17H20N6O4S
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO : ≥ 51.7 mg/mL; 127.83 mM
  • SMILES
    CCOC(=O)Nc1cc(nn2c(C)nnc12)c1cc(NS(=O)(=O)C)c(C)cc1
  • Chemical Name
    ethyl (3-methyl-6-(4-methyl-3-(methylsulfonamido)phenyl)-[1,2,4]triazolo[4,3-b]pyridazin-8-yl)carbamate

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.15th HELLENIC SYMPOSIUM OF MEDICINAL CHEMISTRY.
molnova catalog
related products
  • Goodyeroside A

    Goodyeroside A is a glycoside compound derived from the plant Goodyera that exhibits significant hepatoprotective activity. It can inhibit liver damage induced by carbon tetrachloride in primary cultured rat hepatocytes.

  • [Tyr1]-pTH (1-34) (r...

    [Tyr1]-pTH (1-34) (rat)

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.