Bromosporine
CAS No. 1619994-69-2
Bromosporine( Bromosporine )
Catalog No. M18093 CAS No. 1619994-69-2
Bromosporine is a broad spectrum inhibitor for bromodomains for BRD2/4/9 and CECR2 (IC50: 0.41/0.29/0.122/0.017 μM), respectively.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 1 mL x 10 mM in DMSO | 93 | In Stock |
|
| 2MG | 52 | In Stock |
|
| 5MG | 85 | In Stock |
|
| 10MG | 136 | In Stock |
|
| 25MG | 275 | In Stock |
|
| 50MG | 431 | In Stock |
|
| 100MG | 687 | In Stock |
|
| 200MG | 918 | In Stock |
|
| 500MG | Get Quote | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameBromosporine
-
NoteResearch use only, not for human use.
-
Brief DescriptionBromosporine is a broad spectrum inhibitor for bromodomains for BRD2/4/9 and CECR2 (IC50: 0.41/0.29/0.122/0.017 μM), respectively.
-
DescriptionBromosporine is a broad spectrum inhibitor for bromodomains and as such will be very useful in elucidating further biological roles of reader domains as well as a tool for the validation of functional assays. Proteins that contain BRDs have been implicated in the development of a large variety of diseases, including various cancers, inflammatory diseases and neurological diseases and the therapeutic potential of bromodomain inhibition has been shown in several of these diseases, such as HIV, cancer and inflammation.
-
In VitroCell Proliferation Assay Cell Line:HCT116 and HT29 Concentration:0, 30, 60, 120, 240, 480 and 1000 nM Incubation Time:72 h Result:Synergistically inhibited cell growth in CRC cells with 5-FU (HY-90006) (0-16 μg/mL) and exhibited a dose-dependent manner.Cell Cycle Analysis Cell Line:HCT116 and HT29 Concentration:Various concentration Incubation Time:48 h Result:Caused a distinct increase in the cells arrested at G1 phase when combined with 5-FU (HY-90006). Western Blot Analysis Cell Line:HCT116 and HT29 Concentration:Various concentration Incubation Time:48 h Result:Elevated the level of apoptosis in both cell lines through cleavage of PARP, caspase 3, and 9.Cell Proliferation Assay Cell Line:MV4;11, KASUMI-1, OCI-AML3 and K562 Concentration:0.1, 0.5 and 1 μM Incubation Time:6-10 days Result:Inhibited these AML cells in a dose-dependent manner.Cell Cytotoxicity Assay Cell Line:PBMCs Concentration:1 μM, 2.5 μM, 5 μM, 10 μM, 25 μM and 50 μM Incubation Time:48 hResult:Did not induce marked toxicity in primary CD4+ T cells with CC50 over 10 μM.
-
In VivoAnimal Model:Female BALB/c nude mice (5-6 weeks; injected with 1?×?106?cells/100?μL of HT116?cells) Dosage:100 mg/kg Administration:i.p.; daily for 10 days Result:Exhibited better antitumor activity than individual Bromosporine or 5-FU (HY-90006) when co-treated with the two agent.
-
SynonymsBromosporine
-
PathwayOthers
-
TargetOther Targets
-
RecptorBRD
-
Research AreaOthers-Field
-
Indication——
Chemical Information
-
CAS Number1619994-69-2
-
Formula Weight404.45
-
Molecular FormulaC17H20N6O4S
-
Purity>98% (HPLC)
-
SolubilityDMSO : ≥ 51.7 mg/mL; 127.83 mM
-
SMILESCCOC(=O)Nc1cc(nn2c(C)nnc12)c1cc(NS(=O)(=O)C)c(C)cc1
-
Chemical Nameethyl (3-methyl-6-(4-methyl-3-(methylsulfonamido)phenyl)-[1,2,4]triazolo[4,3-b]pyridazin-8-yl)carbamate
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1.15th HELLENIC SYMPOSIUM OF MEDICINAL CHEMISTRY.
molnova catalog
related products
-
Goodyeroside A
Goodyeroside A is a glycoside compound derived from the plant Goodyera that exhibits significant hepatoprotective activity. It can inhibit liver damage induced by carbon tetrachloride in primary cultured rat hepatocytes.
-
[Tyr1]-pTH (1-34) (r...
[Tyr1]-pTH (1-34) (rat)
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
Cart
sales@molnova.com