Neohesperidin

CAS No. 13241-33-3

Neohesperidin( Neohesperidin | Hesperetin 7-Neohesperidoside | NSC 31048 )

Catalog No. M17949 CAS No. 13241-33-3

Neohesperidin with antioxidant and neuroprotective properties.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 41 In Stock
50MG 36 In Stock
100MG 47 In Stock
200MG Get Quote In Stock
500MG 176 In Stock
1G 290 In Stock

Biological Information

  • Product Name
    Neohesperidin
  • Note
    Research use only, not for human use.
  • Brief Description
    Neohesperidin with antioxidant and neuroprotective properties.
  • Description
    Neohesperidin is a flavonoid found in citrus fruit peel that has diverse biological activities. Neohesperidin Exerts Lipid-Regulating Effects in vitro and in vivo via Fibroblast Growth Factor 21 and AMP-Activated Protein Kinase/Sirtuin Type 1/Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1α Signaling Axis. Neohesperidin suppresses osteoclast differentiation, bone resorption and ovariectomised-induced osteoporosis in mice.(In Vitro):Neohesperidin induces cell apoptosis in human breast adenocarcinoma MDA-MB-231 cells. The IC50 values of neohesperidin at 24 and 48 h are 47.4±2.6 μM and 32.5±1.8 μM, respectively. The expressions of P53 and Bax in the neohesperidin-treated cells are significantly up-regulated, while that of Bcl-2 is down-regulated. Neohesperidin exhibits antioxidant activity (IC50=22.31 μg/mL) in the DPPH radical-scavenging assay.(In Vivo):Neohesperidin (50 mg/kg) significantly inhibits 55.0% of HCl/ethanol-induced gastric lesions. In pylorus ligated rats, neohesperidin (50 mg/kg) significantly decreases the volume of gastric secretion and gastric acid output, and increases the pH. Treatment of neohesperidin significantly decreases fasting glucose, serum glucose, and glycosylated serum protein (GSP) in mice. It significantly elevates oral glucose tolerance and insulin sensitivity and decreases insulin resistance in the diabetic mice. Neohesperidin significantly decreases serum triglycerides, total cholesterol, leptin level, and liver index in the mice.
  • In Vitro
    Neohesperidin induces cell apoptosis in human breast adenocarcinoma MDA-MB-231 cells. The IC50 values of neohesperidin at 24 and 48 h are 47.4±2.6 μM and 32.5±1.8 μM, respectively. The expressions of P53 and Bax in the neohesperidin-treated cells are significantly up-regulated, while that of Bcl-2 is down-regulated. Neohesperidin exhibits antioxidant activity (IC50=22.31 μg/mL) in the DPPH radical-scavenging assay.
  • In Vivo
    Neohesperidin (50 mg/kg) significantly inhibits 55.0% of HCl/ethanol-induced gastric lesions. In pylorus ligated rats, neohesperidin (50 mg/kg) significantly decreases the volume of gastric secretion and gastric acid output, and increases the pH. Treatment of neohesperidin significantly decreases fasting glucose, serum glucose, and glycosylated serum protein (GSP) in mice. It significantly elevates oral glucose tolerance and insulin sensitivity and decreases insulin resistance in the diabetic mice. Neohesperidin significantly decreases serum triglycerides, total cholesterol, leptin level, and liver index in the mice.
  • Synonyms
    Neohesperidin | Hesperetin 7-Neohesperidoside | NSC 31048
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    Others-Field
  • Indication
    ——

Chemical Information

  • CAS Number
    13241-33-3
  • Formula Weight
    610.56
  • Molecular Formula
    C28H34O15
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO : ≥ 30 mg/mL; 49.14 mM
  • SMILES
    C[C@H]1[C@@H]([C@H]([C@@H](O)[C@@H](O1)O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1Oc1cc2O[C@@H](CC(=O)c2c(c1)O)c1ccc(c(c1)O)OC)O)O
  • Chemical Name
    (S)-7-(((2S,3R,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-3-(((2S,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)tetrahydro-2H-pyran-2-yl)oxy)-5-hydroxy-2-(3-hydroxy-4-methoxyphenyl)chroman-4-one

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Lee JH, et al. PhytOthers Res, 2009, 23(12), 1748-1753.
molnova catalog
related products
  • EL-102

    EL-102 is a HIF1α inhibitor with anticancer activity that inhibits microtubule protein polymerization and can be used to study prostate cancer.

  • Eupalitin

    Eupalitin is a natural product for research related to life sciences.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.