Batyl alcohol

CAS No. 544-62-7

Batyl alcohol( NSC 284200 | NSC284200 | NSC-284200 | Batilol )

Catalog No. M14955 CAS No. 544-62-7

Batyl alcohol has been approved in clinical treatment of aleucocytosis that caused by radiotherapy, chemotherapy.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG 31 In Stock
1G 37 In Stock

Biological Information

  • Product Name
    Batyl alcohol
  • Note
    Research use only, not for human use.
  • Brief Description
    Batyl alcohol has been approved in clinical treatment of aleucocytosis that caused by radiotherapy, chemotherapy.
  • Description
    Batyl alcohol has been approved in clinical treatment of aleucocytosis that caused by radiotherapy, chemotherapy.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    NSC 284200 | NSC284200 | NSC-284200 | Batilol
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    Other Indications
  • Indication
    ——

Chemical Information

  • CAS Number
    544-62-7
  • Formula Weight
    344.58
  • Molecular Formula
    C21H44O3
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO: 10 mM
  • SMILES
    OCC(O)COCCCCCCCCCCCCCCCCCC
  • Chemical Name
    1,2-Propanediol, 3-(octadecyloxy)-

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Suemune H, et al. Chem Pharm Bull (Tokyo). 1987 Aug;35(8):3112-8.
molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Hydroxythiohomosilde...

    Hydroxythiohomosildenafil (Sulfohydroxyhomo sildenafil) is a sildenafil analog that may be used to study erectile dysfunction.

  • 6-Fluorotryptamine h...

    6-Fluorotryptamine hydrochloride is a compound used as a molecular building block.