Gimeracil

CAS No. 103766-25-2

Gimeracil( Gimestat )

Catalog No. M10190 CAS No. 103766-25-2

An inhibitor of dihydropyrimidine dehydrogenase, degrades pyrimidine including 5-fluorouracil in the blood.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 30 In Stock
50MG 29 In Stock
100MG 50 In Stock
200MG 59 In Stock
500MG 73 In Stock
1G 107 In Stock

Biological Information

  • Product Name
    Gimeracil
  • Note
    Research use only, not for human use.
  • Brief Description
    An inhibitor of dihydropyrimidine dehydrogenase, degrades pyrimidine including 5-fluorouracil in the blood.
  • Description
    An inhibitor of dihydropyrimidine dehydrogenase, degrades pyrimidine including 5-fluorouracil in the blood; inhibits homologous recombination. Chemotherapeutic Agents Approved(In Vitro):Gimeracil reduces the frequency of neo-positive clones. Additionally, it sensitized the cells in S-phase more than in G0/G1.Gimeracil may enhance the efficacy of radiotherapy through the suppression of HR-mediated DNA repair pathways.Gimeracil pretreatment significantly restrains the formation of radiation-induced foci of Rad51 and RPA, whereas it increased the number of foci of Nbs1, Mre11, Rad50, and FancD2. (In Vivo):Gimeracil (2.5-25 mg/kg, orally) may inhibit the rapid repair of X-ray-induced DNA damage in tumors.
  • In Vitro
    ——
  • In Vivo
    Animal Model:Nude mice (Lu-99, LC-11, KB/C3 and PAN-4 tumors were xenografted).Dosage:2.5-25 mg/kg.Administration:Orally.Result:Exhibited anti-tumor activity.
  • Synonyms
    Gimestat
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    DHPS
  • Research Area
    Cancer
  • Indication
    Chemotherapeutic

Chemical Information

  • CAS Number
    103766-25-2
  • Formula Weight
    145.5438
  • Molecular Formula
    C5H4ClNO2
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO: 29 mg/mL
  • SMILES
    O=C1C=C(O)NC=C1Cl
  • Chemical Name
    2(1H)-Pyridinone, 5-chloro-4-hydroxy-

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Colchicoside

    Colchicoside (3-Demethylcolchicine glucoside) is extracted from Gloriosa superba and shows efficacy in a murine model of pancreatic adenocarcinoma.

  • [D-Arg25]-Neuropepti...

    [D-Arg25]-Neuropeptide Y, human, rat; [D-Arg25]-NPY, human, rat