Isohemiphloin

CAS No. 3682-02-8

Isohemiphloin( —— )

Catalog No. M29310 CAS No. 3682-02-8

Isohemiphloin is a flavonoid isolated from Abrus precatorius Linn.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 231 Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Isohemiphloin
  • Note
    Research use only, not for human use.
  • Brief Description
    Isohemiphloin is a flavonoid isolated from Abrus precatorius Linn.
  • Description
    Isohemiphloin is a flavonoid isolated from Abrus precatorius Linn.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    3682-02-8
  • Formula Weight
    434.4
  • Molecular Formula
    C21H22O10
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    OC[C@H]1O[C@H]([C@H](O)[C@@H](O)[C@@H]1O)c1c(O)cc(O)c2C(=O)C[C@H](Oc12)c1ccc(O)cc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • 24-Methylene cycloar...

    24-Methylenecycloartanyl ferulate, a compound belonging to the γ-oryzanol family, demonstrates the ability to enhance parvin-beta expression within human breast cancer cells.

  • Epcoritamab

    Epcoritamab (GEN3013) is a novel subcutaneous CD3xCD20 bispecific T-cell binding antibody that activates T-cells and directs them to kill malignant CD20(+) B-cells for the study of relapsed or refractory large B-cell lymphoma.