Guaiacol

CAS No. 90-05-1

Guaiacol ( —— )

Catalog No. M16473 CAS No. 90-05-1

Guaiacol is a precursor to various flavorants, such as eugenol and vanillin. Its derivatives are used medicinally as an expectorant, antiseptic, and local anesthetic.

Purity : >98%(HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
500MG 38 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Guaiacol
  • Note
    Research use only, not for human use.
  • Brief Description
    Guaiacol is a precursor to various flavorants, such as eugenol and vanillin. Its derivatives are used medicinally as an expectorant, antiseptic, and local anesthetic.
  • Description
    Guaiacol is a precursor to various flavorants, such as eugenol and vanillin. Its derivatives are used medicinally as an expectorant, antiseptic, and local anesthetic. It also can be used as an indicator in chemical reactions that produce oxygen. When oxygen binds to it, the complex turns yellowish brown and absorbs light maximally at about 470 nm.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    Other Indications
  • Indication
    ——

Chemical Information

  • CAS Number
    90-05-1
  • Formula Weight
    124.14
  • Molecular Formula
    C7H8O2
  • Purity
    >98%(HPLC)
  • Solubility
    DMSO: 10 mM
  • SMILES
    COC1=CC=CC=C1O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Dorfner R, et al. J Agric Food Chem. 2003 Sep 10;51(19):5768-73.
molnova catalog
related products
  • 5-Hydroxypseudobapti...

    The herbs of Lupinus luteus.

  • AI3-17671

    AI3-17671 can be used in recombinant androgen receptor competitive binding assays as an analytical natural, synthetic and environmental chemical.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.