Deacetyltaxol

CAS No. 78432-77-6

Deacetyltaxol( —— )

Catalog No. M15959 CAS No. 78432-77-6

Extracted from Taxus brevifolia barks.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 126 In Stock
10MG 177 In Stock
25MG 417 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Deacetyltaxol
  • Note
    Research use only, not for human use.
  • Brief Description
    Extracted from Taxus brevifolia barks.
  • Description
    Extracted from Taxus brevifolia barks;Store the product in sealed, cool and dry condition.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    Cancer
  • Indication
    ——

Chemical Information

  • CAS Number
    78432-77-6
  • Formula Weight
    811.87
  • Molecular Formula
    C45H49NO13
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO: 10 mM
  • SMILES
    CC1=C2[C@H](C(=O)[C@@]3([C@H](C[C@@H]4[C@]([C@H]3[C@@H]([C@@](C2(C)C)(C[C@@H]1OC(=O)[C@@H]([C@H](C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Grobosch T, et al. J Anal Toxicol. 2012 Jan-Feb;36(1):36-43.
molnova catalog
related products
  • Moschamine

    Moschamine is a very potent compound that is able to inhibit COX-I by 58% and COX-II by 54%, at the concentration of 0.1 μmol L⁻1, it may suppress cAMP formation via binding to 5-HT1 receptors in the cells. Moschamine exerts antitumour effects on HeLa, MCF7 and A431 cells.

  • 4-(2,6,6-Trimethyl-1...

    4-(2,6,6-Trimethyl-1-cyclohexenyl)-3-buten-2-one is a natural product for research related to life sciences.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.