Citral

CAS No. 5392-40-5

Citral( Citral | NSC 6170 | NSC-6170 | NSC6170 )

Catalog No. M18762 CAS No. 5392-40-5

Citral is a clear yellow colored liquid with a lemon-like odor. Less dense than water and insoluble in water. Toxic by ingestion. Used to make other chemicals.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG 39 In Stock
500MG 88 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Citral
  • Note
    Research use only, not for human use.
  • Brief Description
    Citral is a clear yellow colored liquid with a lemon-like odor. Less dense than water and insoluble in water. Toxic by ingestion. Used to make other chemicals.
  • Description
    Citral is a vitamin A antagonist; oxygenated monoterpene; inhibits cytosolic dehydrogenases.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Citral | NSC 6170 | NSC-6170 | NSC6170
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    5392-40-5
  • Formula Weight
    152.23
  • Molecular Formula
    C10H16O
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 50 mg/mL (328.45 mM)
  • SMILES
    CC(=CCCC(=CC=O)C)C
  • Chemical Name
    2,6-Octadienal, 3,7-dimethyl-

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Zheng S, et al. Food Chem. 2015 Jul 1;178:76-81.
molnova catalog
related products
  • Scoparin

    Scoparin has antioxidant activity.Scoparin has antibacterial activity.

  • Worenine

    Worenine is used in the a flurophore switched probe which aids in correction of an abasic site (AP site) caused by the removal of a damaged base in DNA.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.