Cholestyramine

CAS No. 11041-12-6

Cholestyramine( Colestyramine | Cholestyramine resin )

Catalog No. M23306 CAS No. 11041-12-6

Cholestyramine, a bile acid-binding resin, inhibits intestinal bile acid absorption which results in the increasing bile acid synthesis from cholesterol.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
500MG 37 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Cholestyramine
  • Note
    Research use only, not for human use.
  • Brief Description
    Cholestyramine, a bile acid-binding resin, inhibits intestinal bile acid absorption which results in the increasing bile acid synthesis from cholesterol.
  • Description
    Cholestyramine, a bile acid-binding resin, inhibits intestinal bile acid absorption which results in the increasing bile acid synthesis from cholesterol.
  • In Vitro
    Cholestyramine (0.1-50 μg/mL) produced the most dramatic results after a 24-hour exposure; an efflux rate of 65% compared with control cells. Cholestyramine is an anion-exchange resin and is insoluble in water. alcohol, chloro-form, and ether. For the assay, cholestyramine is initially wetted with a small amount of DMSO further diluting with media. A blank sample prepared with dimethylsulfoxide DMSO without cholestyramine displayed no differences from the control samples.
  • In Vivo
    Cholestyramine is a bile acid binding resin and can inhibit intestinal bile acid absorption which results in the increasing bile acid synthesis from cholesterol. Results reveal that GSPE treatment alone, and co-administration with Cholestyramine, regulate BA, cholesterol and TG metabolism differently compare to Cholestyramine administration alone. Notably, GSPE decreases intestinal apical sodium-dependent bile acid transporter (Asbt) gene expression, while Cholestyramine significantly induces expression. Administration with GSPE or Cholestyramine robustly induces hepatic BA biosynthetic gene expression, especially cholesterol 7α-hydroxylase (Cyp7a1), compare to control, while co-administration further enhances expression. Treatment with Cholestyramine induces both intestinal and hepatic cholesterologenic gene expression, while co-administration with GSPE attenuates the Cholestyramine-inducing increase in the liver but not in the intestine. Cholestyramine also induces hepatic lipogenic gene expression, which is attenuated by co-administration with GSPE.
  • Synonyms
    Colestyramine | Cholestyramine resin
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    11041-12-6
  • Formula Weight
    ——
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO: < 1 mg/mL (insoluble or slightly soluble);H2O: < 0.1 mg/mL (insoluble)
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Maugeais C, et al. rHDL administration increases reverse cholesterol transport in mice, but is not additive on top of ezetimibe or cholestyramine treatment. Atherosclerosis. 2013 Jul;229(1):94-101.
molnova catalog
related products
  • AEOL-10150 pentachlo...

    AEOL-10150 pentachloride is a metalloporphyrin catalytic antioxidant. AEOL-10150 pentachloride also is a superoxide dismutase mimetic. Which protects lungs from radiation-induced injury.

  • Cajanine

    Cajaninstilbene acid is a useful organic compound for research related to life sciences.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.