Cart
sales@molnova.com
Home - Products - Others - Other Targets - Brandioside

Brandioside

CAS No. 133393-81-4

Brandioside( —— )

Catalog No. M31509 CAS No. 133393-81-4

Brandioside shows strong antioxidant, and neuroprotective effects, it significantly attenuates glutamate-induced neurotoxicity at concentrations ranging from 0.1 to 10 microM; it exhibits significant inhibition of advanced glycation end product formation with the IC50 value of 4.6-25.7 μM.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 432 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
Group Booking Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Brandioside
  • Note
    Research use only, not for human use.
  • Brief Description
    Brandioside shows strong antioxidant, and neuroprotective effects, it significantly attenuates glutamate-induced neurotoxicity at concentrations ranging from 0.1 to 10 microM; it exhibits significant inhibition of advanced glycation end product formation with the IC50 value of 4.6-25.7 μM.
  • Description
    Brandioside shows strong antioxidant, and neuroprotective effects, it significantly attenuates glutamate-induced neurotoxicity at concentrations ranging from 0.1 to 10 microM; it exhibits significant inhibition of advanced glycation end product formation with the IC50 value of 4.6-25.7 μM
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    133393-81-4
  • Formula Weight
    812.8
  • Molecular Formula
    C37H48O20
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Bruceantinol A

    Bruceantinol A is a natural product from Brucea javanica.

  • Trofinetide

    Trofinetide (NNZ 2566 ) is a peptidomimetic tripeptide Gly-Pro-Glu that has anti-inflammatory and neuroprotective properties against hypoxic-ischemic brain injury and neurodegeneration.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Sign In Join Free