Stains-All

CAS No. 7423-31-6

Stains-All( —— )

Catalog No. M24750 CAS No. 7423-31-6

Stains-All is a cationic dye of carbocyanine.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG 26 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Stains-All
  • Note
    Research use only, not for human use.
  • Brief Description
    Stains-All is a cationic dye of carbocyanine.
  • Description
    Stains-All is a cationic dye of carbocyanine.
  • In Vitro
    Almost all of the proteins found in skeletal muscle extracts, including the Ca2++Mg2+-ATPase and the 53,000-Da glycoprotein of the sarcoplasmic reticulum, are stained red or pink with Stains-all. Calsequestrin, the 1 60,000-Da glycoprotein, and 170,000-Da protein are stained blue with Stains-all. The ratio of Stains-all staining (measured at 615 nm) to that of Coomassie blue staining (measured at 575 nm) is 1.3 for calsequestrin, 2.0 for calmodulin, 1.4 for troponin C, and 2.2 for S-100. Therefore, in addition to differentially staining these Ca2+-binding proteins blue, Stains-all is a more sensitive stain for these Ca2+-binding proteins than is Coomassie blue.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    7423-31-6
  • Formula Weight
    559.58
  • Molecular Formula
    C30H27BrN2S2
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:9.5 mg/mL (16.98 mM; ultrasonic and warming and heat to 60°C)
  • SMILES
    CCN1c(c2ccccc2cc2)c2SC1=CC(C)=Cc1[n+](CC)c(c2ccccc2cc2)c2s1.[Br-]
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Campbell KP, et al. Staining of the Ca2+-binding proteins, calsequestrin, calmodulin, troponin C, and S-100, with the cationic carbocyanine dye "Stains-all". J Biol Chem. 1983 Sep 25;258(18):11267-73.
molnova catalog
related products
  • GIBH-130

    A novel inhibitor of neuroinflammation, suppresses the proinflammatory cytokine production in LPS-stimulated N9 microglial cells (IC50=3.4 nM).

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Merafloxacin

    Merafloxacin is a fluoroquinolone antibacterial, which was also identified as a 1 PRF inhibitor of SARS-CoV-2.