Secnidazole

CAS No. 3366-95-8

Secnidazole( PM 185184 | RP 14539 )

Catalog No. M14142 CAS No. 3366-95-8

Secnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 31 In Stock
10MG 45 In Stock
25MG 52 In Stock
50MG 81 In Stock
100MG 97 In Stock
200MG 116 In Stock
500MG 140 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Secnidazole
  • Note
    Research use only, not for human use.
  • Brief Description
    Secnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective.
  • Description
    Secnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective. Effectiveness in the treatment of dientamoebiasis has been reported. Secnidazole is structurally related to the commonly used 5-nitroimidazoles metronidazole and tinidazole. (In Vitro):Secnidazole (RP-14539) (0-5000 μM; 5 or 10 min) inhibits CYP2C19 and CYP3A4, with IC50 values of 3873 μM and 3722 μM, respectively.Secnidazole (0-5000 μM; 5 or 10 min) does not exhibit time-dependent inhibition.Secnidazole (0-5000 μM; 5 or 10 min) has an apparent IC50 value of 503 μM for direct inhibition of human ALDH2.Secnidazole (0-5000 μM; 5 or 10 min) has concentration-dependent inhibition at higher concentration with some of the CYP isoforms notably CYP2A6, CYP2B6, and CYP2D6.Secnidazole (10 μL; 20 h; the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL) inhibits S.marcescens growth with a MIC50 value of 10 mg/mL.(In Vivo):Secnidazole (100 μL; ip.; for 5 days) has protective activity against S.marcescens pathogenesis and can diminish its pathogenesis in mice.
  • In Vitro
    Secnidazole (RP-14539) (0-5000 μM; 5 or 10 min) inhibits CYP2C19 and CYP3A4, with IC50 values of 3873 μM and 3722 μM, respectively.Secnidazole (0-5000 μM; 5 or 10 min) does not exhibit time-dependent inhibition. Secnidazole (0-5000 μM; 5 or 10 min) has an apparent IC50 value of 503 μM for direct inhibition of human ALDH2.Secnidazole (0-5000 μM; 5 or 10 min) has concentration-dependent inhibition at higher concentration with some of the CYP isoforms notably CYP2A6, CYP2B6, and CYP2D6.Secnidazole (10 μL; 20 h; the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL) inhibits S.marcescens growth with a MIC50 value of 10 mg/mL. Cell Viability Assay Cell Line:S.marcescens Concentration:10 μL (the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL)Incubation Time:20 hResult:Had no inhibitory effect on S.marcescens growth at 2 mg/mL (equivalent to 1/5 MIC).
  • In Vivo
    Secnidazole (100 μL; ip.; for 5 days) has protective activity against S.marcescens pathogenesis and can diminish its pathogenesis in mice. Animal Model:Female healthy albino mice Dosage:100 μL Administration:100 μL; ip.; for 5 days Result:Significantly diminished the bacteria s capacity to kill mice.
  • Synonyms
    PM 185184 | RP 14539
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    Infection
  • Indication
    ——

Chemical Information

  • CAS Number
    3366-95-8
  • Formula Weight
    185.18
  • Molecular Formula
    C7H11N3O3
  • Purity
    >98% (HPLC)
  • Solubility
    Ethanol: 37 mg/mL (199.8 mM); Water: 37 mg/mL (199.8 mM); DMSO: 37 mg/mL (199.8 mM)
  • SMILES
    (2RS)-(2-methyl-5-nitro-1H-imidazol-1-yl)propan-2-ol
  • Chemical Name
    1-(2-methyl-5-nitro-1H-imidazol-1-yl)propan-2-ol

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. De Backer, et al. Clinical Microbiology and Infection 16 (5): 470–472.
molnova catalog
related products
  • Lariciresinol 4-O-gl...

    The roots of Stellera chamaejasme L.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Solvent Blue 35

    Solvent Blue 35 (Sudan Blue II) is a dye used for coloring hydrocarbon-based and alcoholic solvents. It is used for staining triglycerides in animal tissues.