Secnidazole
CAS No. 3366-95-8
Secnidazole( PM 185184 | RP 14539 )
Catalog No. M14142 CAS No. 3366-95-8
Secnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 5MG | 31 | In Stock |
|
| 10MG | 45 | In Stock |
|
| 25MG | 52 | In Stock |
|
| 50MG | 81 | In Stock |
|
| 100MG | 97 | In Stock |
|
| 200MG | 116 | In Stock |
|
| 500MG | 140 | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameSecnidazole
-
NoteResearch use only, not for human use.
-
Brief DescriptionSecnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective.
-
DescriptionSecnidazole (trade names Flagentyl, Sindose, Secnil) is a nitroimidazole anti-infective. Effectiveness in the treatment of dientamoebiasis has been reported. Secnidazole is structurally related to the commonly used 5-nitroimidazoles metronidazole and tinidazole. (In Vitro):Secnidazole (RP-14539) (0-5000 μM; 5 or 10 min) inhibits CYP2C19 and CYP3A4, with IC50 values of 3873 μM and 3722 μM, respectively.Secnidazole (0-5000 μM; 5 or 10 min) does not exhibit time-dependent inhibition.Secnidazole (0-5000 μM; 5 or 10 min) has an apparent IC50 value of 503 μM for direct inhibition of human ALDH2.Secnidazole (0-5000 μM; 5 or 10 min) has concentration-dependent inhibition at higher concentration with some of the CYP isoforms notably CYP2A6, CYP2B6, and CYP2D6.Secnidazole (10 μL; 20 h; the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL) inhibits S.marcescens growth with a MIC50 value of 10 mg/mL.(In Vivo):Secnidazole (100 μL; ip.; for 5 days) has protective activity against S.marcescens pathogenesis and can diminish its pathogenesis in mice.
-
In VitroSecnidazole (RP-14539) (0-5000 μM; 5 or 10 min) inhibits CYP2C19 and CYP3A4, with IC50 values of 3873 μM and 3722 μM, respectively.Secnidazole (0-5000 μM; 5 or 10 min) does not exhibit time-dependent inhibition. Secnidazole (0-5000 μM; 5 or 10 min) has an apparent IC50 value of 503 μM for direct inhibition of human ALDH2.Secnidazole (0-5000 μM; 5 or 10 min) has concentration-dependent inhibition at higher concentration with some of the CYP isoforms notably CYP2A6, CYP2B6, and CYP2D6.Secnidazole (10 μL; 20 h; the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL) inhibits S.marcescens growth with a MIC50 value of 10 mg/mL. Cell Viability Assay Cell Line:S.marcescens Concentration:10 μL (the secnidazole solution was two-fold serially diluted using Mueller–Hinton broth to obtain dilutions ranging from 80 to 0.3125 mg/mL)Incubation Time:20 hResult:Had no inhibitory effect on S.marcescens growth at 2 mg/mL (equivalent to 1/5 MIC).
-
In VivoSecnidazole (100 μL; ip.; for 5 days) has protective activity against S.marcescens pathogenesis and can diminish its pathogenesis in mice. Animal Model:Female healthy albino mice Dosage:100 μL Administration:100 μL; ip.; for 5 days Result:Significantly diminished the bacteria s capacity to kill mice.
-
SynonymsPM 185184 | RP 14539
-
PathwayOthers
-
TargetOther Targets
-
RecptorOthers
-
Research AreaInfection
-
Indication——
Chemical Information
-
CAS Number3366-95-8
-
Formula Weight185.18
-
Molecular FormulaC7H11N3O3
-
Purity>98% (HPLC)
-
SolubilityEthanol: 37 mg/mL (199.8 mM); Water: 37 mg/mL (199.8 mM); DMSO: 37 mg/mL (199.8 mM)
-
SMILES(2RS)-(2-methyl-5-nitro-1H-imidazol-1-yl)propan-2-ol
-
Chemical Name1-(2-methyl-5-nitro-1H-imidazol-1-yl)propan-2-ol
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1. De Backer, et al. Clinical Microbiology and Infection 16 (5): 470–472.
molnova catalog
related products
-
Lariciresinol 4-O-gl...
The roots of Stellera chamaejasme L.
-
Exendin-4 peptide de...
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
-
Solvent Blue 35
Solvent Blue 35 (Sudan Blue II) is a dye used for coloring hydrocarbon-based and alcoholic solvents. It is used for staining triglycerides in animal tissues.
Cart
sales@molnova.com