Phenol-13C6

CAS No. 89059-34-7

Phenol-13C6( —— )

Catalog No. M34999 CAS No. 89059-34-7

Phenol-13C6 is a 13C-labeled Phenol, which is an important chemical raw material used in the manufacture of fungicides and herbicides.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 93 Get Quote
5MG 135 Get Quote
10MG 188 Get Quote
25MG 319 Get Quote
50MG 475 Get Quote
100MG 673 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Phenol-13C6
  • Note
    Research use only, not for human use.
  • Brief Description
    Phenol-13C6 is a 13C-labeled Phenol, which is an important chemical raw material used in the manufacture of fungicides and herbicides.
  • Description
    Phenol-13C6 is a 13C-labeled Phenol, which is an important chemical raw material used in the manufacture of fungicides and herbicides.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    89059-34-7
  • Formula Weight
    100.07
  • Molecular Formula
    13C6H6O
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    O[13C]1=[13CH][13CH]=[13CH][13CH]=[13CH]1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Ethylhexylglycerin

    Ethylhexylglycerin (Octoxyglycerin) is a surfactant with moisturizing and lubricating properties.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • (R,S) AMPA

    AMPA is the definitive agonist of the AMPA glutamatergic ionotropic receptor