Norepinephrine

CAS No. 51-41-2

Norepinephrine( Levarterenol | L-Noradrenaline )

Catalog No. M18698 CAS No. 51-41-2

Norepinephrine can stimulate apoptosis in adult rat ventricular myocytes by activation of the β-adrenergic pathway.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG 37 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Norepinephrine
  • Note
    Research use only, not for human use.
  • Brief Description
    Norepinephrine can stimulate apoptosis in adult rat ventricular myocytes by activation of the β-adrenergic pathway.
  • Description
    Norepinephrine can stimulate apoptosis in adult rat ventricular myocytes by activation of the β-adrenergic pathway. It can up-regulate the expression of vascular endothelial growth factor, matrix metalloproteinase (MMP)-2, and MMP-9 in nasopharyngeal carcinoma tumour cells.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Levarterenol | L-Noradrenaline
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    MMP-2| MMP-9
  • Research Area
    Others-Field
  • Indication
    ——

Chemical Information

  • CAS Number
    51-41-2
  • Formula Weight
    169.18
  • Molecular Formula
    C8H11NO3
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 50 mg/mL (295.54 mM)
  • SMILES
    NC[C@H](O)c1ccc(O)c(O)c1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Ngan Kee W D, et al. Anesthesiology, 2015, 122(4):736-745.
molnova catalog
related products
  • Olumacostat glasaret...

    A small molecule inhibitor of acetyl coenzyme A (CoA) carboxylase (ACC); inhibits de novo lipid synthesis in primary and transformed human sebocytes.

  • L-Propargylglycine

    L-Propargylglycine is an inhibitor of the enzyme.l-propargylglycine (LPG) irreversibly inhibited the enzyme from Crotalus adamanteus and Crotalus atrox in a dose- and time-dependent manner.?Inactivation was irreversible which was significantly protected by the substrate l-phenylalanine.?

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.