MLC - derived peptide

CAS No. ———

MLC - derived peptide( ——— )

Catalog No. M41964 CAS No. ———

MLC - derived peptide

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote

Biological Information

  • Product Name
    MLC - derived peptide
  • Note
    Research use only, not for human use.
  • Brief Description
    MLC - derived peptide
  • Description
    MLC - derived peptide
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    1578.85
  • Molecular Formula
    C70H115N25O17
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • SJ572403

    SJ572403 is an inhibitor of disordered protein p27.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • ISOBERGAPTEN

    ISOBERGAPTEN is a plant growth regulating substance it is the principal constituents responsible for the antimycobacterial activity of the roots of Heracleum maximum;?it may form an important class of natural defensive agents against fungi.