Home - Products - Others - Other Targets - IL-1 Receptor Peptide (human)

IL-1 Receptor Peptide (human)

CAS No. 141801-03-8

IL-1 Receptor Peptide (human)( ——— )

Catalog No. M41556 CAS No. 141801-03-8

IL-1 Receptor Peptide (human)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    IL-1 Receptor Peptide (human)
  • Note
    Research use only, not for human use.
  • Brief Description
    IL-1 Receptor Peptide (human)
  • Description
    IL-1 Receptor Peptide (human)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    141801-03-8
  • Formula Weight
    1073.37
  • Molecular Formula
    C47H88N14O12S
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • pTH-Related Protein ...

    pTH-Related Protein (1-37) (human, mouse, rat), the peptide analogue of pTH-Related Protein (pTHrP). pTHrP refers to parathyroid-hormone-related protein, involved in physiological regulation of bone formation.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Swertianolin

    Swertianolin, mangiferin, rhodenthoside A-C, isoorientin, isovitexin, and amarogentin would serve as potential chemotaxonomic markers to differentiate Gentianaceae species.