Home - Products - Others - Other Targets - [Tyr0]-Hypercalcemia Malignancy Factor (1-40)

[Tyr0]-Hypercalcemia Malignancy Factor (1-40)

CAS No. ———

[Tyr0]-Hypercalcemia Malignancy Factor (1-40)( ——— )

Catalog No. M41293 CAS No. ———

[Tyr0]-Hypercalcemia Malignancy Factor (1-40)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    [Tyr0]-Hypercalcemia Malignancy Factor (1-40)
  • Note
    Research use only, not for human use.
  • Brief Description
    [Tyr0]-Hypercalcemia Malignancy Factor (1-40)
  • Description
    [Tyr0]-Hypercalcemia Malignancy Factor (1-40)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    4838.6
  • Molecular Formula
    C216H343N67O60
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Gossypetin 3-O-β-glu...

    Herbacetin 3-O-glucopyranoside-8-O-glucuronopyranoside is a flavonoid glycoside that can be isolated from Malope trifida Cav.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 4,6-Dibromoindole

    4,6-Dibromoindole is a marine derived natural products found in Glossobalanus sp.