Home - Products - Others - Other Targets - pTH-Related Protein (1-16) (human, mouse, rat)

pTH-Related Protein (1-16) (human, mouse, rat)

CAS No. 126391-27-3

pTH-Related Protein (1-16) (human, mouse, rat)( ——— )

Catalog No. M40393 CAS No. 126391-27-3

pTH-Related Protein (1-16) (human, mouse, rat)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    pTH-Related Protein (1-16) (human, mouse, rat)
  • Note
    Research use only, not for human use.
  • Brief Description
    pTH-Related Protein (1-16) (human, mouse, rat)
  • Description
    pTH-Related Protein (1-16) (human, mouse, rat)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    126391-27-3
  • Formula Weight
    ———
  • Molecular Formula
    ———
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • MALAT1-IN-1

    MALAT1-IN-1 modulated Malat1 downstream genes in a dose-dependent manner without affecting the expression of nuclear enriched abundant transcript 1 (Neat1).

  • α-Conotoxin GS

    α-Conotoxin GS