Home - Products - Others - Other Targets - (Tyr0,Trp2)-Melanocyte-Stimulating Hormone-Release Inhibiting Factor

(Tyr0,Trp2)-Melanocyte-Stimulating Hormone-Release Inhibiting Factor

CAS No. 144450-13-5

(Tyr0,Trp2)-Melanocyte-Stimulating Hormone-Release Inhibiting Factor( ——— )

Catalog No. M40022 CAS No. 144450-13-5

Tyr-W-MIF-1 is an opioid tetrapeptide with opiate and antiopiate activity. Tyr-W-MIF-1 can induce analgesia.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote

Biological Information

  • Product Name
    (Tyr0,Trp2)-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
  • Note
    Research use only, not for human use.
  • Brief Description
    Tyr-W-MIF-1 is an opioid tetrapeptide with opiate and antiopiate activity. Tyr-W-MIF-1 can induce analgesia.
  • Description
    Tyr-W-MIF-1 is an opioid tetrapeptide with opiate and antiopiate activity. Tyr-W-MIF-1 can induce analgesia.
  • In Vitro
    ———
  • In Vivo
    Animal Model:Rats Dosage:200 μg in 5 μL Administration:Intracerebroventricular injection (i.c.v)Result:Prolonged analgesia, measured by latency to remove the tail from a heating element.
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    144450-13-5
  • Formula Weight
    520.59
  • Molecular Formula
    C27H32N6O5
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Yang YR, et L. Opioid and antiopioid actions of Tyr-MIF-1, Tyr-W-MIF-1 and hemorphin-4 on rat locus coeruleus neurons: intracellular recording in vitro. Chin J Physiol. 1997 Sep 30;40(3):131-5. ?
molnova catalog
related products
  • Allitol

    Allitol is a substrate for the production of L-form ketoses and aldoses.

  • Cortagine

    Potent and selective corticotrophin releasing factor receptor 1 (CRF1) agonist (EC50 = 0.18 nM for rat CRF1). Displays anxiolytic and antidepressant activity in vivo. Microinfusion into mouse prefrontal cortex reduces defensive behavior in vivo.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.