Lucidone A

CAS No. 97653-92-4

Lucidone A( ——— )

Catalog No. M38478 CAS No. 97653-92-4

Lucidone A is a lanostanoid isolated from the fruiting bodies of G. resinaceum. lucidone A showed inhibitory effects against the increase of ALT and AST levels in HepG2 cells induced by H2O2 compared to a control group in the range of their maximum non-toxic concentration (MNTC) .

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Lucidone A
  • Note
    Research use only, not for human use.
  • Brief Description
    Lucidone A is a lanostanoid isolated from the fruiting bodies of G. resinaceum. lucidone A showed inhibitory effects against the increase of ALT and AST levels in HepG2 cells induced by H2O2 compared to a control group in the range of their maximum non-toxic concentration (MNTC) .
  • Description
    Lucidone A is a natural product from Ganoderma lucidum (Leyss. Ex Fr.) Karst.
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    97653-92-4
  • Formula Weight
    402.52
  • Molecular Formula
    C24H34O5
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Peng XR,et al. Protective effects of triterpenoids from Ganoderma resinaceum on H?O?-induced toxicity in HepG2 cells. Food Chem. 2013 Nov 15;141(2):920-6.?
molnova catalog
related products
  • Obestatin (rat)

    Obestatin(rat), encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) has anti-inflammatory, anti-myocardial infarction and antioxidant activities.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • alpha-(3,4-Dihydroxy...

    Danshensu has antioxidant activity, can enhance HO-1 expression to suppress 6-OHDA-induced oxidative damage via PI3K/Akt/Nrf2 signaling pathways.