Home - Products - Others - Other Targets - 2-[dodecyl(2-hydroxyethyl)amino]ethanol

2-[dodecyl(2-hydroxyethyl)amino]ethanol

CAS No. 1541-67-9

2-[dodecyl(2-hydroxyethyl)amino]ethanol( —— )

Catalog No. M37477 CAS No. 1541-67-9

2-[dodecyl(2-hydroxyethyl)amino]ethanol (N-Lauryldiethanolamine) is a surfactant that can also be used as an emulsifier and wetting agent in skin care products.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G 27 In Stock

Biological Information

  • Product Name
    2-[dodecyl(2-hydroxyethyl)amino]ethanol
  • Note
    Research use only, not for human use.
  • Brief Description
    2-[dodecyl(2-hydroxyethyl)amino]ethanol (N-Lauryldiethanolamine) is a surfactant that can also be used as an emulsifier and wetting agent in skin care products.
  • Description
    2-[dodecyl(2-hydroxyethyl)amino]ethanol (N-Lauryldiethanolamine) is a surfactant that can also be used as an emulsifier and wetting agent in skin care products.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1541-67-9
  • Formula Weight
    273.45
  • Molecular Formula
    C16H35NO2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    CCCCCCCCCCCCN(CCO)CCO
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 3-Methylcarbazole

    3-Methylcarbazole (NSC-10154) is an carbazole alkaloid compound with anticancer effects.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • H-DL-Val-OEt HCl

    H-DL-Val-OEt HCl is a valine derivative that inhibits excessive secretion of sebum from the scalp.