Compound C749

CAS No. 57-03-4

Compound C749( —— )

Catalog No. M35290 CAS No. 57-03-4

Compound C749 is a useful organic compound for research related to life sciences. The catalog number is T50125 and the CAS number is 57-03-4.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 29 In Stock
10MG 46 In Stock
25MG 67 In Stock
50MG 99 In Stock
100MG 140 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Compound C749
  • Note
    Research use only, not for human use.
  • Brief Description
    Compound C749 is a useful organic compound for research related to life sciences. The catalog number is T50125 and the CAS number is 57-03-4.
  • Description
    (Rac)-sn-Glycerol 3-phosphate is an a-site substrate analogue. (Rac)-sn-Glycerol 3-phosphate is bound to the a-site, the rate of reaction of indole and nucleophilic indole analogues with E(A-A) is strongly inhibited.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    57-03-4
  • Formula Weight
    172.073
  • Molecular Formula
    C3H9O6P
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    OCC(O)COP(O)(O)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Dunn MF, et al. The tryptophan synthase bienzyme complex transfers indole between the alpha- and beta-sites via a 25-30 A long tunnel. Biochemistry. 1990;29(37):8598-8607.?
molnova catalog
related products
  • Fuchsine base monohy...

    Fuchsine base monohydrochloride is a magenta dye and uses for acid-fast staining with carbol-fuchsin.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • MC-Val-Ala-PAB-PNP

    MC-Val-Ala-PAB-PNP is a cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs).