S3QEL-2

CAS No. 890888-12-7

S3QEL-2( —— )

Catalog No. M34135 CAS No. 890888-12-7

S3QEL-2 is a selective complex III superoxide-producing site inhibitor with neuroprotective effects that inhibits PC-3 cell proliferation in pyruvate-starved medium in a dose-dependent manner.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 63 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    S3QEL-2
  • Note
    Research use only, not for human use.
  • Brief Description
    S3QEL-2 is a selective complex III superoxide-producing site inhibitor with neuroprotective effects that inhibits PC-3 cell proliferation in pyruvate-starved medium in a dose-dependent manner.
  • Description
    S3QEL-2, a suppressor of superoxide production from mitochondrial complex III, potently and selectively suppresses site IIIQo superoxide production (IC50=1.7 μM). S3QEL-2 does not affect oxidative phosphorylation, and normal electron flux. S3QEL-2 inhibits HIF-1α accumulation.
  • In Vitro
    S3QELs-2 protects against ROS-induced, JNK-mediated cell stress in pancreatic β-cells and S3QEL-2 strongly mitigates the oxidative stress-induced apoptosis that limits the yield of functional β-cells from intact islets.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Mitochondrial Metabolism
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    890888-12-7
  • Formula Weight
    323.44
  • Molecular Formula
    C19H25N5
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 50 mg/mL (154.59 mM; Ultrasonic )
  • SMILES
    N=1C=NC(=C2C=NN(C12)C3=CC=C(C(=C3)C)C)N(CCC)CCC
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Orr AL, et al. Suppressors of superoxide production from mitochondrial complex III. Nat Chem Biol. 2015;11(11):834-836.?
molnova catalog
related products
  • 5'-Deoxy-5-fluorocyt...

    5'-Deoxy-5-fluorocytidine is an intermediate metabolite of the DNA synthesis inhibitor capecitabine.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • D-Xylose

    D-Xylose ((2S,3R,4S,5R)-oxane-2,3,4,5-tetrol) is a monosaccharide widely found in yeast and involved in the metabolism of the organism.