Retrofractamide C

CAS No. 96386-33-3

Retrofractamide C( —— )

Catalog No. M32662 CAS No. 96386-33-3

The fruits of Piper nigrum L.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 461 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Retrofractamide C
  • Note
    Research use only, not for human use.
  • Brief Description
    The fruits of Piper nigrum L.
  • Description
    The fruits of Piper nigrum L.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    96386-33-3
  • Formula Weight
    329.4
  • Molecular Formula
    C20H27NO3
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Pyrocurzerenone

    Pyrocurzerenone is a natural product for research related to life sciences.

  • Allisartan Isoproxil

    Allisartan Isoproxil, an angiotensin II receptor antagonist, is used to treat mild to moderate essential hypertension.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.