Home - Products - Others - Other Targets - 5-Hydroxy-3,6,7,4-tetramethoxyflavone

5-Hydroxy-3,6,7,4-tetramethoxyflavone

CAS No. 14787-34-9

5-Hydroxy-3,6,7,4-tetramethoxyflavone( —— )

Catalog No. M32461 CAS No. 14787-34-9

5-Hydroxy-3,6,7,4'-tetramethoxyflavone is a natural product for research related to life sciences.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 1422 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    5-Hydroxy-3,6,7,4-tetramethoxyflavone
  • Note
    Research use only, not for human use.
  • Brief Description
    5-Hydroxy-3,6,7,4'-tetramethoxyflavone is a natural product for research related to life sciences.
  • Description
    5-Hydroxy-3,6,7,4'-tetramethoxyflavone is a natural product for research related to life sciences.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    14787-34-9
  • Formula Weight
    358.4
  • Molecular Formula
    C19H18O7
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • PKI-tide

    PKItide exhibits an IC50 of 0.2 μM for cAMP-PK.

  • WYC-210

    WYC-210 is a retinoid compound,and with lower anticancer activity.